DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42231 and HYLS1

DIOPT Version :9

Sequence 1:NP_001137828.1 Gene:CG42231 / 7354432 FlyBaseID:FBgn0087041 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001128265.1 Gene:HYLS1 / 219844 HGNCID:26558 Length:299 Species:Homo sapiens


Alignment Length:173 Identity:41/173 - (23%)
Similarity:64/173 - (36%) Gaps:58/173 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 EKECKTDKDDDLKE----------RSDGGASFADLARLFKEQLLMDASVPPMSANNAVPQKSQVN 143
            |.|..|:.|.||.:          :.|..:|| |:::.|.                 :|.:.|..
Human   117 ESESGTENDQDLWDLRQRLMNVQFQEDKESSF-DVSQKFN-----------------LPHEYQGI 163

  Fly   144 GRRRSRSKTRREKAPSISSSESEANEDRLRMQRRRRSKSHPRSASNRRSGSVHQRRKSMHCDPVA 208
            .:.:.....:||      ...|.|.|..|.:..|.:|...|:.....|:     |.|:   |.||
Human   164 SQDQLICSLQRE------GMGSPAYEQDLIVASRPKSFILPKLDQLSRN-----RGKT---DRVA 214

  Fly   209 LFQYYQKEWAHFRSQIPGEN----TRIGVR----------SKP 237
            .:..|:::|...|  :|||:    .|.|||          |||
Human   215 RYFEYKRDWDSIR--LPGEDHRKELRWGVREQMLCRAEPQSKP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42231NP_001137828.1 HYLS1_C 197..>234 CDD:291957 13/40 (33%)
HYLS1NP_001128265.1 HYLS1_C 198..284 CDD:405899 20/68 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR34174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.