DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42231 and hyls-1

DIOPT Version :9

Sequence 1:NP_001137828.1 Gene:CG42231 / 7354432 FlyBaseID:FBgn0087041 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_504840.1 Gene:hyls-1 / 179118 WormBaseID:WBGene00015466 Length:274 Species:Caenorhabditis elegans


Alignment Length:251 Identity:55/251 - (21%)
Similarity:94/251 - (37%) Gaps:54/251 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LNDLGYRNISAEQLREFLKDLRKLIKHEERLAEN----AKESDFSGLHKRGTVSSRAKLSLDK-- 73
            |:.:|:......|...|..::..|:..|..|::.    ..||.|:.|    :|...|:....:  
 Worm    14 LHQMGHHIHDKNQFATFKNEIDNLLDRELCLSDADEDVMNESLFASL----SVDPAAQFIRQERN 74

  Fly    74 -DKENAAPSCPCPSAKEK---------ECKTDKDDDLKERSDGGASFADLARLFKEQLLMDASVP 128
             ..||.....|..|.|.:         |.::|.||:......            :..||:|.:..
 Worm    75 FPTENLNIQSPIVSRKRQGKRFIYENVELQSDFDDESSNEYP------------ERNLLVDRAWR 127

  Fly   129 PM-----SANNAVP--QKSQVNG---RRRSRSKTRREKAPSIS---SSESEANEDRLRMQRRRRS 180
            .:     :.|.|..  :...::|   :.||........|.|:|   |:|:|.:|    :|:..|.
 Worm   128 SIHRAMETCNGATETLKSISLDGSDIQERSSVDDEENIAESVSVGLSTETEQSE----LQKSSRP 188

  Fly   181 KSHPRSASNRRSGSVHQRRKSMHCDPVALFQYYQKEWAHFRSQIPGENTRIGVRSK 236
            :   :....|...|:...|.....|||..:.:|:.||.  |...|||..|:.:|.|
 Worm   189 E---KEVWTRNVLSLEPGRAPKKYDPVTRYHFYKSEWD--RHPAPGEMRRLSLRWK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42231NP_001137828.1 HYLS1_C 197..>234 CDD:291957 12/36 (33%)
hyls-1NP_504840.1 HYLS1_C 195..>250 CDD:317684 16/47 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014397
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR34174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.