Sequence 1: | NP_001137828.1 | Gene: | CG42231 / 7354432 | FlyBaseID: | FBgn0087041 | Length: | 242 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009304140.1 | Gene: | hyls1 / 100147862 | ZFINID: | ZDB-GENE-141222-88 | Length: | 1052 | Species: | Danio rerio |
Alignment Length: | 221 | Identity: | 50/221 - (22%) |
---|---|---|---|
Similarity: | 83/221 - (37%) | Gaps: | 64/221 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 AKLSLDKDKENAAPSCPCPSAKEKECKTDKDDDLKERSDGGASFADLARLFKEQLLMDA---SVP 128
Fly 129 -PMSANN------AVPQKSQVNG------RRRSRSKTR--------------------------- 153
Fly 154 -----------REKAPSISSSESEANEDRLRMQRRRRSKS--HPRSASNRRSGSVHQRRKSM-HC 204
Fly 205 DPVALFQYYQKEWAHFRSQIPGENTR 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42231 | NP_001137828.1 | HYLS1_C | 197..>234 | CDD:291957 | 12/35 (34%) |
hyls1 | XP_009304140.1 | HYLS1_C | 954..1041 | CDD:291957 | 14/41 (34%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 76 | 1.000 | Inparanoid score | I5257 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1441118at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR34174 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.160 |