DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42231 and hyls1

DIOPT Version :9

Sequence 1:NP_001137828.1 Gene:CG42231 / 7354432 FlyBaseID:FBgn0087041 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_009304140.1 Gene:hyls1 / 100147862 ZFINID:ZDB-GENE-141222-88 Length:1052 Species:Danio rerio


Alignment Length:221 Identity:50/221 - (22%)
Similarity:83/221 - (37%) Gaps:64/221 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 AKLSLDKDKENAAPSCPCPSAKEKECKTDKDDDLKERSDGGASFADLARLFKEQLLMDA---SVP 128
            |:.|.|..|:|.......||..|:.....|:|:..|.|    |..::| .|.|.|.::|   |:.
Zfish   779 AQQSHDGFKDNKPQFPDLPSQAEQHQSPAKNDNATEES----SSQNVA-YFNEGLELEALRYSLD 838

  Fly   129 -PMSANN------AVPQKSQVNG------RRRSRSKTR--------------------------- 153
             |.:..:      ..|::.|.:|      :||..::.|                           
Zfish   839 HPFNLRHRRGRVQKRPEERQYHGGYDEEHQRRKETRVRAYAGCLGTVSELEERLDQMRIPTSRVH 903

  Fly   154 -----------REKAPSISSSESEANEDRLRMQRRRRSKS--HPRSASNRRSGSVHQRRKSM-HC 204
                       .::..|::...|.|.:..:|...|..|:|  .||..|..|....|...::: ..
Zfish   904 YDSESEETESYTDRTSSVTEESSSAFQQYIRGMTRSHSESDIRPRPKSFIRPVFDHPHTRNLKKT 968

  Fly   205 DPVALFQYYQKEWAHFRSQIPGENTR 230
            ||||.:..|::||..|:.  |||.:|
Zfish   969 DPVAKYLQYKQEWEMFKP--PGEKSR 992

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42231NP_001137828.1 HYLS1_C 197..>234 CDD:291957 12/35 (34%)
hyls1XP_009304140.1 HYLS1_C 954..1041 CDD:291957 14/41 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5257
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1441118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR34174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.160

Return to query results.
Submit another query.