DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42306 and Ubxn6

DIOPT Version :9

Sequence 1:NP_001137700.1 Gene:CG42306 / 7354425 FlyBaseID:FBgn0259202 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001366290.1 Gene:Ubxn6 / 66530 MGIID:1913780 Length:442 Species:Mus musculus


Alignment Length:132 Identity:31/132 - (23%)
Similarity:47/132 - (35%) Gaps:35/132 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VESFNSTLQSIARQVEQ----------FAGVALTAAVDLRGNL---ESLTGDFRW-----ENGPI 53
            ||..:|......|:.|:          ...|.|.....|:|..   |.|:..||:     :|..:
Mouse   311 VERLSSLRTKAMREKEEQRELRKYTYALVRVRLPDGCLLQGTFYAREKLSALFRFVREALQNDWL 375

  Fly    54 AFTDLQAT---LLKVLIVLLLGTC-----VLAGYSWS--------IYGKVITEKFVRPSTLKEIE 102
            .| :|:|:   .|:....|.|..|     .|..:||.        ..|....:..:||..|..||
Mouse   376 PF-ELRASGGQKLEENEALALNECGLVPSALLTFSWDASVLEDIRAAGAEPAKSVLRPELLAAIE 439

  Fly   103 EL 104
            :|
Mouse   440 QL 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42306NP_001137700.1 None
Ubxn6NP_001366290.1 Mediates interaction with LMAN1. /evidence=ECO:0000250|UniProtKB:Q9BZV1 1..10
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..111
VCP/p97-interacting motif (VIM). /evidence=ECO:0000250|UniProtKB:Q9BZV1 51..63
PUB_UBXD1 158..261 CDD:198418
UBX_UBXN6 336..409 CDD:340536 17/73 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2699
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.