DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42306 and ubxn6

DIOPT Version :9

Sequence 1:NP_001137700.1 Gene:CG42306 / 7354425 FlyBaseID:FBgn0259202 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001038245.1 Gene:ubxn6 / 554960 ZFINID:ZDB-GENE-030131-5680 Length:437 Species:Danio rerio


Alignment Length:45 Identity:14/45 - (31%)
Similarity:19/45 - (42%) Gaps:2/45 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LLGTCVLAGYSWSIYGKVIT-EKFVRPSTLKEIE-ELKLSVAKLK 112
            :.|...||........||.| :..:|....:|:| |....||.||
Zfish    51 MAGAAALARIEQQHRPKVHTSQDAIRNQVKRELEAEAAAVVASLK 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42306NP_001137700.1 None
ubxn6NP_001038245.1 PUB_UBXD1 154..256 CDD:198418
UBQ 330..403 CDD:294102
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2699
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.