powered by:
Protein Alignment CG42306 and ubxn6
DIOPT Version :9
Sequence 1: | NP_001137700.1 |
Gene: | CG42306 / 7354425 |
FlyBaseID: | FBgn0259202 |
Length: | 121 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001038245.1 |
Gene: | ubxn6 / 554960 |
ZFINID: | ZDB-GENE-030131-5680 |
Length: | 437 |
Species: | Danio rerio |
Alignment Length: | 45 |
Identity: | 14/45 - (31%) |
Similarity: | 19/45 - (42%) |
Gaps: | 2/45 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 70 LLGTCVLAGYSWSIYGKVIT-EKFVRPSTLKEIE-ELKLSVAKLK 112
:.|...||........||.| :..:|....:|:| |....||.||
Zfish 51 MAGAAALARIEQQHRPKVHTSQDAIRNQVKRELEAEAAAVVASLK 95
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42306 | NP_001137700.1 |
None |
ubxn6 | NP_001038245.1 |
PUB_UBXD1 |
154..256 |
CDD:198418 |
|
UBQ |
330..403 |
CDD:294102 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2699 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.