powered by:
Protein Alignment CG42306 and CG33722
DIOPT Version :9
Sequence 1: | NP_001137700.1 |
Gene: | CG42306 / 7354425 |
FlyBaseID: | FBgn0259202 |
Length: | 121 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001027152.1 |
Gene: | CG33722 / 3772658 |
FlyBaseID: | FBgn0064126 |
Length: | 478 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 21/70 - (30%) |
Similarity: | 31/70 - (44%) |
Gaps: | 11/70 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 PIAFTDLQATLLKVLIVLLLGTCVLAGYSWSIYGKVITEKFVRPSTLKEIEELKLSVAKLKLPKE 116
|.:|.||....||:::..|..|. |......::|.| |:|:|..|..:|||...|:
Fly 307 PDSFFDLTVNDLKMVLRDLKRTS-----SGDDDAPLLTAK------LRELERQKAMLAKLNQYKD 360
Fly 117 HSPRI 121
...||
Fly 361 CVLRI 365
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42306 | NP_001137700.1 |
None |
CG33722 | NP_001027152.1 |
TUG-UBL1 |
8..71 |
CDD:288347 |
|
UBQ |
360..429 |
CDD:294102 |
2/6 (33%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2699 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.