DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsun5 and NCL1

DIOPT Version :9

Sequence 1:NP_650787.1 Gene:Nsun5 / 7354421 FlyBaseID:FBgn0259704 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_009529.1 Gene:NCL1 / 852257 SGDID:S000000120 Length:684 Species:Saccharomyces cerevisiae


Alignment Length:249 Identity:64/249 - (25%)
Similarity:96/249 - (38%) Gaps:58/249 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 TVLDMCAAPGMKTVHICNVM-----QNKGCIYSVEQDHVRYNTLCEITKDAGCDIVKPILGDALN 289
            ||||||||||.||..:...:     :..|.:.:.:.|..|.:.|....|......:..:..||  
Yeast   168 TVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDADARRSHMLVHQLKRLNSANLMVVNHDA-- 230

  Fly   290 LTPERFPDV---------------EYILVDPSCSGSG-MQNRMTVCDEPKEDKRLQKLQGLQIKI 338
               :.||.:               :.||.|..|||.| |:..:.|..:......| .|..:|:.|
Yeast   231 ---QFFPRIRLHGNSNNKNDVLKFDRILCDVPCSGDGTMRKNVNVWKDWNTQAGL-GLHAVQLNI 291

  Fly   339 LSHAMGAFPNVKRIAYCTCSLWKEENEQVVQRCL-QLNPSFKLLSCKKALR--------NKW--- 391
            |:..:....|..|:.|.||||...|||.||...| :.....:|::|...|.        :||   
Yeast   292 LNRGLHLLKNNGRLVYSTCSLNPIENEAVVAEALRKWGDKIRLVNCDDKLPGLIRSKGVSKWPVY 356

  Fly   392 -HNVGDKDYPNIG------------------KNVLYCQPDSDLTDGIFLALFEK 426
             .|:.:|...:.|                  :|.:...|....|.|.|:.:|||
Yeast   357 DRNLTEKTKGDEGTLDSFFSPSEEEASKFNLQNCMRVYPHQQNTGGFFITVFEK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsun5NP_650787.1 RsmB <124..428 CDD:223222 64/249 (26%)
NCL1NP_009529.1 RsmB 1..411 CDD:223222 64/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0144
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.