DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsun5 and NSUN7

DIOPT Version :9

Sequence 1:NP_650787.1 Gene:Nsun5 / 7354421 FlyBaseID:FBgn0259704 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_078953.4 Gene:NSUN7 / 79730 HGNCID:25857 Length:718 Species:Homo sapiens


Alignment Length:492 Identity:107/492 - (21%)
Similarity:180/492 - (36%) Gaps:146/492 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 RATAKILKAALEQQKCIKTLI-------------------------FAEKHARTRSLHTVLKKFS 54
            |.:.::..:||:.|..::|::                         |.::..:||.|       |
Human    88 RLSYELAFSALKYQDILETILIDSCIFPSTTIPDHLSSLIIVMLYDFQDRKFQTRVL-------S 145

  Fly    55 ENRVALEKAIEETGLLRDNPSFDPSLAKILVTELLFGRKELNGESKPV-----QTVRSYKDRLLN 114
            :|...:.:..|...||.   ||...||..|      .|..:..::..:     :|||  |..|  
Human   146 DNEEPISEVQEVENLLN---SFKIKLAAAL------ARCRIKHDALSIYHILPETVR--KQEL-- 197

  Fly   115 SIRDFGVQRKEPNPRYVRINTNLYSLAEALDYLHKSDWRRKELPADASYADFLTAIKSLAENEFM 179
                    |....|.|..|||...|..|..:.|.:..:.:            :.::..:.:..|.
Human   198 --------RASTLPLYAWINTCKISPEEVYNNLKRRGYNK------------VKSVLHIDDKVFA 242

  Fly   180 TDLHVEGVLIFPAKWSNYWVRHPLVHSKRFILQNKATCLAA-----------ELLAPPSGA--TV 231
            .|.|...|||||:...|..:...|....:.|.|:|:..||.           ::|...:|:  ||
Human   243 VDQHCYDVLIFPSHLKNDLINIDLFKDYKLIFQDKSRSLAVHSVKALLNMDDDVLMVNTGSWYTV 307

  Fly   232 LDMCAAPGMKT--VHICNVMQNKGCIYSVEQDHVRYNTLCEITKDAGCDIVKPILGDALNLTPE- 293
            ..|.......|  |.:|.|           |...:...|..:....||..::.:....:|:..: 
Human   308 SHMSILTNNNTSKVFVCGV-----------QSQAKDPDLKTLFTKIGCKNIEILHEKFINIESKD 361

  Fly   294 -RFPDVEYILVDPSCSGSGMQNRMTVCDEPKED--------------KRLQKLQGLQIKILSHAM 343
             |...|:.||:.|.|||.|:.|.:.......||              .:|..|...|.:.|:|||
Human   362 HRLQKVKVILLLPRCSGLGVSNPVEFILNEHEDTEFLKDHSQGGISVDKLHVLAQQQYEQLTHAM 426

  Fly   344 GAFPNVKRIAYCTCSLWKEENEQVVQRCLQLNPSFKLLSCKKALRNKWHNVGDKDYP-------- 400
             .|...:.:.|||||::.||||.||               ||||  ::.::|:|..|        
Human   427 -KFTKAQAVVYCTCSVFPEENEAVV---------------KKAL--EFQDLGNKGQPYRLSPPVL 473

  Fly   401 --------NIGKNVLYCQPDSDLTDGIFLALFEKRRE 429
                    .:..:..:....|::|:|.||::..:.|:
Human   474 PLCSLKEIQLSTDKFFRMEPSEITNGCFLSILTRERD 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsun5NP_650787.1 RsmB <124..428 CDD:223222 80/350 (23%)
NSUN7NP_078953.4 Methyltr_RsmF_N 131..509 CDD:330305 101/446 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 536..557
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 578..616
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 694..718
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0144
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1128973at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.780

Return to query results.
Submit another query.