DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsun5 and NSUN3

DIOPT Version :9

Sequence 1:NP_650787.1 Gene:Nsun5 / 7354421 FlyBaseID:FBgn0259704 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_071355.1 Gene:NSUN3 / 63899 HGNCID:26208 Length:340 Species:Homo sapiens


Alignment Length:300 Identity:77/300 - (25%)
Similarity:117/300 - (39%) Gaps:70/300 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 LDYLHKSDWRRKEL-------------PADASYADFLTAIKSLAENEFMTDLHVEGV-LIFPAKW 194
            ||:..|.  ..|||             |:...||..|.......|.|  .|||::|. .:.....
Human    22 LDHFEKQ--YSKELGDAWNTVREILTSPSCWQYAVLLNRFNYPFELE--KDLHLKGYHTLSQGSL 82

  Fly   195 SNY----------------WVRHPLVHSKRFILQNKATCLAAELLAPPSGATVLDMCAAPGMKTV 243
            .||                ..||.:.:.|::.|.|.|:.|....|....|..|||:|||||.|::
Human    83 PNYPKSVKCYLSRTPGRIPSERHQIGNLKKYYLLNAASLLPVLALELRDGEKVLDLCAAPGGKSI 147

  Fly   244 HI----CNVMQNKGCIYSVEQDHVRYNTLCEITKDAGCDIVKPI-------------LGDALNLT 291
            .:    |     .|.::..|.|.:|...|.:..:..   |.:|:             :|||   .
Human   148 ALLQCAC-----PGYLHCNEYDSLRLRWLRQTLESF---IPQPLINVIKVSELDGRKMGDA---Q 201

  Fly   292 PERFPDVEYILVDPSCSGSGMQNRMTVCDEPKEDKRL---QKLQGLQIKILSHAMGAFPNVKRIA 353
            ||.|   :.:|||..||..  ::.:...|..|...|:   :.|..|||::|..|:.|......:.
Human   202 PEMF---DKVLVDAPCSND--RSWLFSSDSQKASCRISQRRNLPLLQIELLRSAIKALRPGGILV 261

  Fly   354 YCTCSLWKEENEQVVQRCLQLNPSFKLLSCKKALRNKWHN 393
            |.||:|.|.||:.|:...|..:.:...:..|...|...|:
Human   262 YSTCTLSKAENQDVISEILNSHGNIMPMDIKGIARTCSHD 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsun5NP_650787.1 RsmB <124..428 CDD:223222 77/299 (26%)
NSUN3NP_071355.1 AdoMet_MTases 124..332 CDD:302624 52/193 (27%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01023 139..145 5/5 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0144
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.