DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsun5 and nsun3

DIOPT Version :9

Sequence 1:NP_650787.1 Gene:Nsun5 / 7354421 FlyBaseID:FBgn0259704 Length:433 Species:Drosophila melanogaster
Sequence 2:XP_005159976.1 Gene:nsun3 / 553534 ZFINID:ZDB-GENE-050706-95 Length:374 Species:Danio rerio


Alignment Length:337 Identity:83/337 - (24%)
Similarity:133/337 - (39%) Gaps:51/337 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 SKP----VQTVRSYKDRLLNSIRDFGVQRKEPNPRYVRINTNLYSLAEALDYLHKSDWRR-KELP 158
            |||    .:||..|.||..:  .:.|.|..  |.|.|.:|...:.....|:..  ||... |:..
Zfish    44 SKPQKQLCETVLKYFDRQYS--EELGEQWW--NARDVLLNPLSWQYGVLLNRF--SDLTNLKQCL 102

  Fly   159 ADASYADFL-----TAIKSLAENEFMTDLHVEGVLIFPAKWSNYWVRHPLVHSKRFILQNKATCL 218
            |:..|.:.|     .:....|:......:|.:.|.|........|:       |::.|.|.|:.|
Zfish   103 AELGYTNLLQQTHPESHSQTADIPLQCFIHPDPVRIPTQSHHTGWL-------KQYYLLNAASLL 160

  Fly   219 AAELLAPPSGATVLDMCAAPGMKTVHICNVMQNKGCIYSVEQDHVRYNTLCEITKDAGCDIVKPI 283
            ....|....|..|||:|||||.|::.|... ...|.::..|.|..|::.|.:..:    ..|.|.
Zfish   161 PVLALNVQEGENVLDLCAAPGGKSLAILQT-ATPGLLHCNEVDQHRHDWLLKTLE----SYVPPS 220

  Fly   284 LGDALNLTPERFPDV--------EYILVDPSCSGSGMQNRMTVCDEPKED---KRLQKLQGLQIK 337
            |...|::|.:....:        :.:|||..||..  ::.:...|..:.:   |...:|..||.:
Zfish   221 LRHLLSVTLQDGRSIGTMQPGAYDKVLVDAPCSND--RSWLYTPDTHRGEMWLKERTQLPLLQKE 283

  Fly   338 ILSHAMGAFPNVKRIAYCTCSLWKEENEQVVQRCLQLNPSFKL----------LSCKKALRNKWH 392
            :|..|:.|......:.|.||::.:.||:.||:..|...|..:|          ||......:...
Zfish   284 LLCSALAAVRPGGIVVYSTCTMSRAENQSVVEEVLASYPGVELQELEQQFIDSLSDHFCFAHLHP 348

  Fly   393 NVGDKDYPNIGK 404
            :||....|..||
Zfish   349 SVGQLVIPQKGK 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsun5NP_650787.1 RsmB <124..428 CDD:223222 73/308 (24%)
nsun3XP_005159976.1 AdoMet_MTases 162..330 CDD:302624 45/174 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0144
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.