DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsun5 and CG11109

DIOPT Version :9

Sequence 1:NP_650787.1 Gene:Nsun5 / 7354421 FlyBaseID:FBgn0259704 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_730761.1 Gene:CG11109 / 40507 FlyBaseID:FBgn0037200 Length:439 Species:Drosophila melanogaster


Alignment Length:267 Identity:63/267 - (23%)
Similarity:108/267 - (40%) Gaps:88/267 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 ILQNKATCLAAELLAPPSGATVLDMCAAPGMKTVHICNVMQNKGCIYSVEQDHVRYNTLC----- 269
            :|||..:.:...:|.|..|..:||||||||.||.||..:|.::|.:.:::....|..::.     
  Fly   210 LLQNLPSIVCVRVLDPQPGERILDMCAAPGNKTSHIAELMGDRGSVVALDNSASRVRSMLPKLGH 274

  Fly   270 ---------EITKDAGCDIVKPILGDALNLTPERFP--DVEYILVDPSCSGSGMQNRMTVCDEPK 323
                     ..|:....|.....:|:   .|...||  ..:.||:|..|||.|  ||..:....|
  Fly   275 YKSITAHVFNSTEAVAADAPSAPVGE---FTGPPFPCESFDRILLDAPCSGLG--NRPQLSCSIK 334

  Fly   324 EDKRLQKLQGLQIKILSHAMGAFPNVKR---------------IAYCTCSLWKEENEQVV----Q 369
                       |:|:||    ::|:::|               :.|.||::.::|.|.:|    :
  Fly   335 -----------QVKVLS----SYPHIQRRLFEQAVQLVRPGGILVYSTCTVTEDECECLVAWALR 384

  Fly   370 RCLQLN---------------PSFKLLSCKKALRNKWHNVGDKDYPNIGKNVLYCQPDSDLTDGI 419
            :.::|.               |.|:  :||..|..::...|               .::| |.|.
  Fly   385 KFVELRLTDATPRWGGPGLPLPGFE--ACKSRLLQRFGPSG---------------ANAD-TVGF 431

  Fly   420 FLALFEK 426
            |:|.|:|
  Fly   432 FIAKFQK 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsun5NP_650787.1 RsmB <124..428 CDD:223222 63/267 (24%)
CG11109NP_730761.1 PUA 102..>171 CDD:214635
RsmB <207..439 CDD:223222 63/267 (24%)
AdoMet_MTases 222..437 CDD:302624 58/252 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437690
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0144
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22807
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.