DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsun5 and CG8545

DIOPT Version :9

Sequence 1:NP_650787.1 Gene:Nsun5 / 7354421 FlyBaseID:FBgn0259704 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_610786.2 Gene:CG8545 / 36365 FlyBaseID:FBgn0033741 Length:891 Species:Drosophila melanogaster


Alignment Length:471 Identity:98/471 - (20%)
Similarity:171/471 - (36%) Gaps:146/471 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ILKAALEQQKCIKTLIFAEKHARTRSLHTVLKKFSENRVALEKAIEETGLLRDNPSFDPSLAKIL 84
            :.:..:|.::..|.|...|...|.:.:..||..|...|.|.....|...|||             
  Fly   271 VFQLPVEGEETEKDLTLQEVQQRIKDVSLVLSDFKRYRQADRSRGEYIDLLR------------- 322

  Fly    85 VTELLFGRKELNGESKPVQTVRSYKDRLLNSIRDFGVQRKEPNPRYVRINTNLYSLAEALDYLHK 149
                           :.:....||.:.|:..:.|                  :..|.|.::||..
  Fly   323 ---------------RDLCLYYSYNEFLMEKLMD------------------MLPLTELMEYLEA 354

  Fly   150 SDWRRKELPADASYADFLTAIKSLAENEFMTDLHVEGVLIFP-AKWS-----------------N 196
            |:..|   |.........|..:.||     ..|...||.:.| .||:                 .
  Fly   355 SEIAR---PLTIRTNTLKTRRRDLA-----GALINRGVNLDPLGKWTKVGLVVFNSQVPLGATPE 411

  Fly   197 YWVRHPLVHSKRFILQNKATCLAAELLAPPSGATVLDMCAAPGMKTVHICNVMQNKGCIYSVEQD 261
            |...|       :::|..::.|....|||.....:||||:|||.|..||.::|:|.|.:::    
  Fly   412 YLAGH-------YMIQGASSLLPVMALAPQENERILDMCSAPGGKGSHIASIMKNTGVLFA---- 465

  Fly   262 HVRYNTLCEITKDAGCDIVKPILGDALNL----------TPERFPDV----EYILVDPSCSGSGM 312
                       .|:..|.:|.|:.:...|          ...:|.::    :.:|:|..|:|:|:
  Fly   466 -----------NDSNRDRIKAIVANFHRLGIVNAVVSCEDGTKFRNIMTGFDRVLLDAPCTGTGV 519

  Fly   313 QNRMTVCDEPKEDKRLQKLQGLQIKILSHAM---------GAFPNVKRIAYCTCSLWKEENEQVV 368
            .::.......|.:..:|:...||.|:|..|:         |.:     |.|.|||:..||||.|:
  Fly   520 VSKDPSVKTTKSEVDVQRCYNLQRKLLLTAIDCTDAKSSTGGY-----IVYSTCSVLPEENEWVI 579

  Fly   369 -----QRCLQLNPS---FKLLSCKKALRNKWHNVGDKDYPNIGKNVLYCQPDSDLTDGIFLALFE 425
                 :|.::|.|:   |.:....|..::::|       |::.....| .|.:...||.::|..:
  Fly   580 DYALKKRNVKLVPTGLDFGVEGFTKFRQHRFH-------PSLNLTKRY-YPHTHNMDGFYVAKLK 636

  Fly   426 K--------RREGEKD 433
            |        :.:.|:|
  Fly   637 KFSNTIPITKEQQEED 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsun5NP_650787.1 RsmB <124..428 CDD:223222 78/360 (22%)
CG8545NP_610786.2 Methyltr_RsmF_N 333..424 CDD:293730 21/123 (17%)
nop2p 363..637 CDD:188051 70/313 (22%)
Nol1_Nop2_Fmu 428..636 CDD:279522 57/235 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437689
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0144
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1128973at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22807
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.