DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsun5 and Nsun4

DIOPT Version :9

Sequence 1:NP_650787.1 Gene:Nsun5 / 7354421 FlyBaseID:FBgn0259704 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001100148.1 Gene:Nsun4 / 298426 RGDID:1559652 Length:381 Species:Rattus norvegicus


Alignment Length:239 Identity:55/239 - (23%)
Similarity:100/239 - (41%) Gaps:51/239 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 FILQNKATCLAAELLAPPSGATVLDMCAAPGMKTVHICNVMQNKGCIYSVEQDHVRYNTLCEITK 273
            :.|.:.|:.|....|....|..|||:|||||.||:    .:...||..::..:.:..:....:.|
  Rat   152 YYLMDAASLLPVLALGLQHGDIVLDLCAAPGGKTL----ALLQTGCCRNLAANDLSTSRTGRLQK 212

  Fly   274 DAGCDIVKPI-LGDALNLTP---ERFPDVE-----YILVDPSCS---GSGMQNRMTVCDEPKEDK 326
            .....:.:.| .|:.:.:|.   .::.::|     .:|||..|:   .|..::...:....::.:
  Rat   213 VLHSYVPQDIRKGNHIRVTSWDGRKWGELEGDTYDKVLVDVPCTTDRHSLHEDENNIFQRSRKKE 277

  Fly   327 RLQKLQGLQIKILSHAMGAFPNVKRIAYCTCSLWKEENEQVVQRCLQLNPS-------------F 378
            | |.|..||:::|...:.|......:.|.||||...:||.|||..::|..:             |
  Rat   278 R-QMLPMLQVQLLGAGLLATKPGGHVVYSTCSLSHLQNEYVVQGAIELLANQYNIKVQVEDLSHF 341

  Fly   379 KLL---------SCKKALRNKWHNVGDKDYPNIGKN---VLYCQ 410
            :.|         ||:         ||:...||:..|   :.:|:
  Rat   342 RKLFMDTFCFLPSCQ---------VGELVIPNLMANFGPMYFCK 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsun5NP_650787.1 RsmB <124..428 CDD:223222 55/239 (23%)
Nsun4NP_001100148.1 AdoMet_MTases 163..>322 CDD:302624 41/163 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0144
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.