DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsun5 and Nsun2

DIOPT Version :9

Sequence 1:NP_650787.1 Gene:Nsun5 / 7354421 FlyBaseID:FBgn0259704 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_663329.3 Gene:Nsun2 / 28114 MGIID:107252 Length:757 Species:Mus musculus


Alignment Length:399 Identity:86/399 - (21%)
Similarity:136/399 - (34%) Gaps:106/399 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 PRYVRINTNLYSLAEALDYLHKSDW------RRKELPAD---ASYADFLTAIKSLAENEF---MT 180
            |..|:.|.......:.|..:.:.:|      .|:.|||.   ..|......|....:|::   :.
Mouse    39 PEIVKENKLFEHYYQELKIVPEGEWDQFMESLREPLPATLRITGYKSHAKEILHCLKNKYFKELE 103

  Fly   181 DLHVEGVLI--------FP--------------------AKWSNYWVRHPLVHSKRFILQNKATC 217
            ||.|:|..:        :|                    ||:..:.|..  ..|.....|...:.
Mouse   104 DLEVDGQKVEVPQPLSWYPEELAWHTNLSRKILRKSPLLAKFHQFLVSE--TESGNISRQEAVSM 166

  Fly   218 LAAELLAPPSGATVLDMCAAPGMKTVHICNVMQ-------NKGCIYSVEQDHVRYNTLCEITKDA 275
            :...||.......:||||||||.||..:..::.       .:|.:.:.:.|:.|...|....|..
Mouse   167 IPPLLLNVEPHHKILDMCAAPGSKTTQLIEMLHADMSVPFPEGFVIANDVDNKRCYLLVHQAKRL 231

  Fly   276 GCDIVKPILGDALNLTPERFPDV---------EYILVDPSCSGSG-MQNRMTVCDEPKEDKRLQK 330
            ....:..:..||.:: |....||         :.||.|..|||.| |:..:.|..:......|| 
Mouse   232 SSPCIMVVNHDASSI-PRLTVDVDGRKEILFYDRILCDVPCSGDGTMRKNIDVWKKWTTLNSLQ- 294

  Fly   331 LQGLQIKILSHAMGAFPNVKRIAYCTCSLWKEENEQVVQRCLQLN-------------PSFKLL- 381
            |.|||::|.:..........|:.|.||||...|:|.|:...|:.:             |..|.: 
Mouse   295 LHGLQLRIATRGAEQLAEGGRMVYSTCSLNPVEDEAVIAALLEKSEGALELADVSAELPGLKWMP 359

  Fly   382 ---SCKKALRN-----KWHNVGDKDYPNIGKNVLYCQPDSDL--------------------TDG 418
               ..|...|:     .||.|....:..|...:.   |.:||                    |.|
Mouse   360 GVSQWKVMTRDGQWFADWHEVPQGRHTQIRPTMF---PPTDLEKLQAMHLERCLRILPHHQNTGG 421

  Fly   419 IFLALFEKR 427
            .|:|:..|:
Mouse   422 FFVAVLVKK 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsun5NP_650787.1 RsmB <124..428 CDD:223222 86/399 (22%)
Nsun2NP_663329.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
RsmB 28..430 CDD:223222 85/397 (21%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01023 184..190 5/5 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 436..504
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 716..757
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0144
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.