DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nsun5 and Nsun3

DIOPT Version :9

Sequence 1:NP_650787.1 Gene:Nsun5 / 7354421 FlyBaseID:FBgn0259704 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_849256.1 Gene:Nsun3 / 106338 MGIID:2146565 Length:348 Species:Mus musculus


Alignment Length:189 Identity:53/189 - (28%)
Similarity:81/189 - (42%) Gaps:28/189 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 RHPLVHSKRFILQNKATCLAAELLAPPSGATVLDMCAAPGMKTVHICNVMQNKGCIYSVEQDHVR 264
            ||.....|::.|.|.|:.|....|....|..|||:|||||.|:|.:..... .|.:...|.|..|
Mouse   104 RHQTGSLKKYYLLNAASLLPVLALELRDGEAVLDLCAAPGGKSVALLQCAY-PGYLLCNEYDRPR 167

  Fly   265 YNTLCEITKDAGCDIVKPI-------------LGDALNLTPERFPDVEYILVDPSCSGSGMQNRM 316
            ...|.:..:..   |.:|:             :|||   .|..|   :.:|||..||..  ::.:
Mouse   168 GRWLRQTLESF---IPQPLINVIKVSELDGREMGDA---QPATF---DKVLVDAPCSND--RSWL 221

  Fly   317 TVCDEPKEDKRL---QKLQGLQIKILSHAMGAFPNVKRIAYCTCSLWKEENEQVVQRCL 372
            ...|..|...|:   :.|..||::::..|:.|......:.|.||:|.|.||:.|:...|
Mouse   222 FSSDSQKAAYRIHQRKNLPVLQVELVRSAIKALRPGGLLVYSTCTLSKAENQDVISEVL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nsun5NP_650787.1 RsmB <124..428 CDD:223222 53/189 (28%)
Nsun3NP_849256.1 AdoMet_MTases 124..332 CDD:302624 46/169 (27%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000255|PROSITE-ProRule:PRU01023 139..145 5/5 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0144
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.