DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42376 and AT5G57815

DIOPT Version :10

Sequence 1:NP_001138136.1 Gene:CG42376 / 7354420 FlyBaseID:FBgn0259722 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_568867.1 Gene:AT5G57815 / 835891 AraportID:AT5G57815 Length:78 Species:Arabidopsis thaliana


Alignment Length:68 Identity:16/68 - (23%)
Similarity:30/68 - (44%) Gaps:9/68 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FPDKAERKKCWNNRDEYWKCLEEHAPKHSSTSGEKVPTPCQSLRKSFEQSCPGQWVKHFDRKRTY 67
            ||...:.:.|:....|:.:|        ::..||: ...|:...|.:...|||:||..::.:|..
plant    16 FPTTNQTRHCFTRYIEFHRC--------TTAKGEE-SNDCERFAKYYRALCPGEWVDKWNEQRES 71

  Fly    68 DQF 70
            ..|
plant    72 GTF 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42376NP_001138136.1 COX6B 3..67 CDD:426708 15/63 (24%)
AT5G57815NP_568867.1 Cyt_c_Oxidase_VIb 3..77 CDD:238466 16/68 (24%)

Return to query results.
Submit another query.