DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42376 and COA6

DIOPT Version :10

Sequence 1:NP_001138136.1 Gene:CG42376 / 7354420 FlyBaseID:FBgn0259722 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_001193570.2 Gene:COA6 / 388753 HGNCID:18025 Length:155 Species:Homo sapiens


Alignment Length:189 Identity:36/189 - (19%)
Similarity:63/189 - (33%) Gaps:56/189 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CTMDLE-ISEKIKAYRQVM--SAKSPSDAALTWNLFDLPNNMELARFFSTLSKEEMAKFEQCVFV 64
            |.|.|. :|.:...|:.|:  |...|:          :|.|:........:......|:    |.
Human  1152 CKMRLSYLSSRTPGYKSVLRISLTHPT----------IPFNLMKVHLMVAVEGRLFRKW----FA 1202

  Fly    65 DGQDPKTYIKMHKMVESTATIALSEEIENKRTILVAEPNRGGVSGHEGEMASTSSGFRDGYHPCM 129
            ...|...|....|           .::.|::...::|             |..|.|:.  |..|.
Human  1203 AAPDLSYYFIWDK-----------TDVYNQKVFGLSE-------------AFVSVGYE--YESCP 1241

  Fly   130 D------HTSYAEGLFTESEK--AWELER--LLKLQKEI---AEAKSKIVKQKKPSIKS 175
            |      .|:..:|...::.|  .|.|::  .|.:|..|   ...:::.|.|:.|.|.|
Human  1242 DLILWEKRTAVLQGYEIDASKLGGWSLDKHHALNIQSGILHKGNGENQFVSQQPPVIGS 1300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42376NP_001138136.1 COX6B 3..67 CDD:426708 12/66 (18%)
COA6NP_001193570.2 Cyt_c_Oxidase_VIb 80..140 CDD:238466
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.