DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7f and Ir75b

DIOPT Version :9

Sequence 1:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_001137966.2 Gene:Ir75b / 8673994 FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster


Alignment Length:377 Identity:74/377 - (19%)
Similarity:133/377 - (35%) Gaps:106/377 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LVIENV--LAQLSTTLVVTISTRHLGTAHWFEYMMNILMDSWRMVAVQLLRIRPDLVVNPVPGRK 110
            |::.|:  :|:||..|::..|..||.           |:...:.:..|...:..|:.:|......
  Fly     7 LILHNLIHMAKLSHVLILHCSLSHLA-----------LLAQSKNIFTQFQPLHSDIQLNDDFLNH 60

  Fly   111 RVSLLMVDSYQGLLDTNI--------TASNANFDDPDYYFI-------FLQARDHLIPKELQLIL 160
            .:..|.|     .||.|.        .||...|....|:::       |.....|.  ||.|:.:
  Fly    61 NILKLGV-----FLDINCDKSGTVLDMASAKRFFSHRYHWLIYDRSMNFSVLESHF--KEAQIFV 118

  Fly   161 DHCLAH---------FWLH------------CNVMIQTAQVEVLV---------YTYYPYTADAC 195
            |..:.:         |.|:            .|:   ||..|:..         |....||..|.
  Fly   119 DADVTYVTHDPFSKNFLLYDVYNKGRQLGGELNI---TADREIFCNKTNCRVERYLSELYTRSAL 180

  Fly   196 QKAYPIPVNTFDGRKWKASQMFPDKLSQMHGCPLTVLTWHQPPFVELVWDPKHNRSRGSGFEIQL 260
            |..     .:|.|...:|:.:       :...||.|       .::.::|     ...|.:.|||
  Fly   181 QHR-----KSFTGLTMRATAV-------VTALPLNV-------SIKEIFD-----FMNSKYRIQL 221

  Fly   261 -----VEHLARR-MNFSLELVNIALLRPNAYRLAEGSSE-GPIEKLLQRNVNISMGYFRKTARRN 318
                 :.:.||: :...|:.....:.|.   |.::|::. |.|..|:....::::..|..:..| 
  Fly   222 DTYARLGYQARQPLRDMLDCKFKYIFRD---RWSDGNATGGMIGDLILDKADLAIAPFIYSFDR- 282

  Fly   319 QLLTTPMSYYSA-NLVAVLQLERYRIGSLALLVF--PFELSVWMLLLLALLI 367
            .|...|::.:|. ..:.:.:..|.....|:...|  ||...||:...|.||:
  Fly   283 ALFLQPITKFSVFREICMFRNPRSVSAGLSATEFLQPFSGGVWLTFALLLLL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 25/136 (18%)
Ir75bNP_001137966.2 Periplasmic_Binding_Protein_Type_2 253..553 CDD:304360 19/83 (23%)
Lig_chan 343..585 CDD:278489
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462793
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.