DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7f and si:ch211-251b21.1

DIOPT Version :9

Sequence 1:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_001138274.1 Gene:si:ch211-251b21.1 / 571720 ZFINID:ZDB-GENE-060809-5 Length:458 Species:Danio rerio


Alignment Length:434 Identity:94/434 - (21%)
Similarity:167/434 - (38%) Gaps:103/434 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 PLTVLTWHQPPFVELVWDPKHNRSRGS---GFEIQLVEHLARRMNFSLELVNIALLRPNAYRLAE 289
            ||.|.|..:.|:.         .|:||   ||.|.::..::.::.|..:   :.|::...|...:
Zfish    24 PLKVTTIKEEPYA---------MSKGSELEGFCIDMLSAISNKLGFKYD---VHLVKDGRYGKTD 76

  Fly   290 --GSSEGPIEKLLQRNVNISMGYFRKTARRNQLLTTPMSYYSANLVAVLQLERYRIGS-----LA 347
              |:..|.|.::::...:|::.....||:|..::.....:....|..::   |..:||     |:
Zfish    77 DSGNWNGMIGEVVRGEADIAVAPLTLTAQREAVVDMSKPFMQTGLSFIM---RKDLGSDDSQFLS 138

  Fly   348 LLVFPFELSVWMLLLLA-LLIHLGIHL-----PSARRGNEEDGGG-------GLQVVALLLGAAL 399
            ||.. |...:||.:|:| ||..:.|.|     |......|:|...       ...|.||.|..| 
Zfish   139 LLKL-FSTEMWMGVLVAYLLTSICIFLVSRISPCEWEQPEKDNNSFTLSHSFWYTVGALTLQGA- 201

  Fly   400 ARLPRSWRHRFIAAHWLWASIPLRISYQSLLFHLIRLQLYNTPSFSL------DQLLAEGFQGIC 458
            ...|::...|.|.:.| |            :|.|:.|..| ..:.||      .||..:.|:.:.
Zfish   202 GPHPKALSGRVITSIW-W------------IFSLVLLACY-FANLSLWLHSDNQQLSIKTFEDLA 252

  Fly   459 TANTQRLLLEMPQLARDPDS---IQSVDTPFDWDV-----------LNVLT--RNRNRKIFAVAN 507
            ..|    ::|...: :|..|   .::.:.|....:           ||...  |...:..:|...
Zfish   253 NQN----VIEYGTI-KDSSSFNFFKNSNNPTYHRIYEHIKEAQSYSLNAAEGFRRAQKGNYAFIG 312

  Fly   508 QDVTLSFLHSSAHPNAFHVVKQPVNVEYAGM-----YMPKHSFLYEKMDDDIRRLDASGFIHAWR 567
            :.|:|..    |.....::.:.|   |..||     ..|..|.|.:.:...|.||..||.:..:|
Zfish   313 ESVSLDL----AVARYCNLTRAP---EIIGMRGYSIAAPLGSPLIKNLSVAILRLSESGELDYFR 370

  Fly   568 RASFASVHRKEQVHMTSR-RYINHAKLSGIYMVMA-----GLYL 605
            ...:||    ..|...|: ..:..|.|.|:::::|     |::|
Zfish   371 SKWWAS----SCVAKDSKGAPLKPASLKGVFLLLAFGLGLGIFL 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 27/136 (20%)
si:ch211-251b21.1NP_001138274.1 PBP2_iGluR_non_NMDA_like 25..375 CDD:270403 83/392 (21%)
Lig_chan 146..396 CDD:278489 61/280 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.