DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7f and grin3a

DIOPT Version :9

Sequence 1:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster
Sequence 2:XP_009303361.1 Gene:grin3a / 564832 ZFINID:ZDB-GENE-130530-780 Length:1111 Species:Danio rerio


Alignment Length:471 Identity:89/471 - (18%)
Similarity:154/471 - (32%) Gaps:167/471 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 WLHCNVMIQTAQVEVLVYTYYPYTADACQKAYPIPVNTFDGRKWKASQMFPDKLSQMHGCPLTVL 232
            |.|..|        |:.|..:|..    :::.|       |..|:.|       |::|   |.|:
Zfish   489 WKHGKV--------VMDYGVWPNK----RRSQP-------GADWRHS-------SRLH---LRVV 524

  Fly   233 TWHQPPFV--------------ELVWDPKHNRS----------RGS-------------GFEIQL 260
            |..:.|||              :|..||..|.:          :|:             |:.|.|
Zfish   525 TLVEHPFVFTRDVDDEGLCPAGQLCLDPLTNDTALLESLFQGLQGANDTVPLEFKKCCYGYCIDL 589

  Fly   261 VEHLARRMNFSLELVNIALLRPNAYRLAEGSSEGPIEKLLQRNVNISMGYFRKTARRNQLLTTPM 325
            :|.||..|.|..:|..:...:..||:  .|...|.:..|:....::::..|...:.|:|::....
Zfish   590 LEKLAEDMGFDFDLYIVGDGKYGAYK--NGRWTGLVGDLMSGAAHLAVTSFSINSARSQVIDFTS 652

  Fly   326 SYYSANLVAVLQLERYRIGSLALLVFPFELSVWMLLLLAL---LIHLGIH-----LPSARRGNEE 382
            .::|.:| .:|...|.....:...::|...|:|:.:.::|   .:.|.::     .....||...
Zfish   653 PFFSTSL-GILVRTRDTAAPIGAFMWPLHWSMWLGIFVSLHVTAVFLTLYEWKSPFGMTPRGRNR 716

  Fly   383 DG----GGGLQV-VALLLG-AALARLPRSWRHRFIAAHWLWASIPLRISYQSLLFHLIRLQLY-- 439
            |.    ...|.| .|:|.| .|..:.|:.|..||:..  |||           :|.|..|..|  
Zfish   717 DRVFSFSSALNVCYAILFGRTAAIKPPKCWTGRFLMN--LWA-----------IFCLFCLSTYTA 768

  Fly   440 NTPSFSLDQLLAEGFQGICTANTQRLLLEMPQLARDPDSIQSVDTPFDWDVLNVLTRNRNRKIFA 504
            |..:..:.:...|...||                .||.                           
Zfish   769 NLAAVMVGEKTYEQLSGI----------------HDPK--------------------------- 790

  Fly   505 VANQDVTLSFLHSSAHPNAFHVVKQPVNVEYAGMYMPK-HSFL-----------YEKMDDDIRRL 557
                      ||..:....|..|::....:|.....|: |.::           .:.:.||.::|
Zfish   791 ----------LHHPSQGFRFGTVRESSAEDYVKKSFPEMHEYMRRYNAPTTPDGIDHLKDDPQKL 845

  Fly   558 DA----SGFIHAWRRA 569
            ||    ...:..|..|
Zfish   846 DAFIMDKALLDYWAHA 861

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 33/163 (20%)
grin3aXP_009303361.1 Periplasmic_Binding_Protein_Type_1 36..502 CDD:299141 5/20 (25%)
ANF_receptor 132..452 CDD:279440
PBP2_iGluR_NMDA_Nr3 518..908 CDD:270438 78/416 (19%)
Lig_chan 682..941 CDD:278489 44/246 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.