DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7f and Ir93a

DIOPT Version :9

Sequence 1:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_650924.3 Gene:Ir93a / 42471 FlyBaseID:FBgn0259215 Length:868 Species:Drosophila melanogaster


Alignment Length:499 Identity:96/499 - (19%)
Similarity:157/499 - (31%) Gaps:161/499 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 FPDKLSQMHGCPLTVLTWHQPPFVELVWDPKHNRSRG-----SGFEIQLVEHLARRMNFSL---- 272
            ||..........:.:||.|.||     |......|.|     .|..:::|:.|:|.:|||.    
  Fly   423 FPHIEHHFRNITMDILTVHNPP-----WQILTKNSNGVIVEHKGIVMEIVKELSRALNFSYYLHE 482

  Fly   273 --------------------ELVNIALLR-PNAYRLAE-------------GSSEGPIEKLLQRN 303
                                |||.....| |  ||:.|             .:.|.|.:|.....
  Fly   483 ASAWKEEDSLSTSAGGNESDELVGSMTFRIP--YRVVEMVQGNQFFIAAVAATVEDPDQKPFNYT 545

  Fly   304 VNISMGYFRKTARRNQ------------------------LLTTPMSYYSANLVAVLQLERYRIG 344
            ..||:..:....|:..                        |||.| :.|:.|.:|  .|:..||.
  Fly   546 QPISVQKYSFITRKPDEVSRIYLFTAPFTVETWFCLMGIILLTAP-TLYAINRLA--PLKEMRIV 607

  Fly   345 SLALLVFPFELSVWMLLLLALLIHLGIHLPSARRGNEEDGGGGLQVVALLLGAALARLPRSWRHR 409
            .|:.:     .|.:..:..|||...|::||:|..|                             |
  Fly   608 GLSTV-----KSCFWYIFGALLQQGGMYLPTADSG-----------------------------R 638

  Fly   410 FIAAHWLWASIPLRISYQSLLFHLIRLQLYNTPSFSLDQL----------LAEG--FQGICTANT 462
            .:...|....|.|..:|...|...:....:......|:||          |..|  |:....:.|
  Fly   639 LVVGFWWIVVIVLVTTYCGNLVAFLTFPKFQPGVDYLNQLEDHKDIVQYGLRNGTFFERYVQSTT 703

  Fly   463 QRLLLEMPQLARDPDSIQSVDTP---------FDWDV-LNVLTR---NRNRKI-FAVANQDVTLS 513
            :.......:.|:...|.|..|..         .||.: |.::.:   .|.::. ||:..:    |
  Fly   704 REDFKHYLERAKIYGSAQEEDIEAVKRGERINIDWRINLQLIVQRHFEREKECHFALGRE----S 764

  Fly   514 FLHSSAHPNAFHVVKQPVNVEYAGMYMPKHSFLYEKMDDDIRRLDASGFIHAWRRASFASVHR-- 576
            |:.                 |...|.:|..|.....::..|:.:...|||..|.:.:..|..:  
  Fly   765 FVD-----------------EQIAMIVPAQSAYLHLVNRHIKSMFRMGFIERWHQMNLPSAGKCN 812

  Fly   577 -KEQVHMTSRRYINHAKLSGIYMVMAGLYLLAGLLFAGEVLLRQ 619
             |......:...:|...:.|.::|:...:.||.|:..||...|:
  Fly   813 GKSAQRQVTNHKVNMDDMQGCFLVLLLGFTLALLIVCGEFWYRR 856

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 41/193 (21%)
Ir93aNP_650924.3 Periplasmic_Binding_Protein_Type_2 429..>697 CDD:328725 61/311 (20%)
Lig_chan 576..836 CDD:306551 58/317 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462915
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.