DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7f and Ir75d

DIOPT Version :9

Sequence 1:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_649074.2 Gene:Ir75d / 40065 FlyBaseID:FBgn0036829 Length:675 Species:Drosophila melanogaster


Alignment Length:316 Identity:60/316 - (18%)
Similarity:103/316 - (32%) Gaps:123/316 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 QLVEHLARRMNFS---LELVNIALLRPNAYRLAEGSSEGPIEKLLQRNVNISMGYFRKTARRNQL 320
            :|:..||.|:|.|   .:.||....:||      ||.:|            .||.|::       
  Fly   295 RLMLELANRLNMSYNTYQTVNYGWRQPN------GSFDG------------LMGRFQR------- 334

  Fly   321 LTTPMSYYS---ANLVAVLQLER----------YRI-----------GSLA-LLVFPFELSVWML 360
                   |.   |.|...::|:|          ||:           .::| :...|||..||:.
  Fly   335 -------YELDLAQLAIFMRLDRIALVDFVAETYRVRAGIMFRQPPLSAVANIFAMPFENDVWVS 392

  Fly   361 LLLALLIHLGIHLPSARRGNEEDGGGGLQVVALLLGAALARLPRSWRHRFIAAH----------- 414
            :|:.|:|                     ..|.|:|            ..|.:.|           
  Fly   393 ILMLLII---------------------TTVVLVL------------ELFFSPHNHDMSYMDTLN 424

  Fly   415 WLWASIPLRISYQSLLFHLIRLQLYNTPSFSLDQLLAEGFQGICTANTQRLLLEMPQLARDPDSI 479
            ::|.::..:..|..:.....|:.::.|  |.....|...|.....|     ||:.|.     |:|
  Fly   425 FVWGAMCQQGFYVEVRNRSARIIVFTT--FVAALFLFTSFSANIVA-----LLQSPS-----DAI 477

  Fly   480 QSV----DTPFDWDVLNVLTRNRNRKIFAVANQDVTLSFLHSSAHPNAFHVVKQPV 531
            ||:    .:|.:   :.|.....|:..|..:...||.:..|........::..:|:
  Fly   478 QSLSDLGQSPLE---IGVQDTQYNKIYFTESTDPVTKNLYHKKIASKGENIYMRPL 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 27/126 (21%)
Ir75dNP_649074.2 Periplasmic_Binding_Protein_Type_2 299..>483 CDD:304360 51/260 (20%)
Lig_chan 388..644 CDD:278489 33/191 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462964
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.