DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7f and Ir68b

DIOPT Version :9

Sequence 1:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster


Alignment Length:431 Identity:79/431 - (18%)
Similarity:140/431 - (32%) Gaps:112/431 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 FDGRKWKASQM---------FPDKLSQMHGCPLTVLTWHQPPFVELVWDPKHNRSRGSGFEIQLV 261
            ||...|...|:         :..|:..:.|.||. .:....|.:.:...|...    :|:  |.|
  Fly   161 FDPFAWGGLQVIQRLDGEVPYARKVKDLRGYPLR-FSMFTDPLMAMPRSPVET----AGY--QAV 218

  Fly   262 EHLARRMNFSLELVNIALLRP---NAYR--LAEGSSEGPIEKLLQRN-----------------V 304
            :.:|.|:...:...::..:.|   .:|.  |..|:..|.:..::..:                 |
  Fly   219 DGVAARVVGEMLNASVTYVFPEDNESYGRCLPNGNYTGVVSDIVGGHTHFAPNSRFVLDCIWPAV 283

  Fly   305 NISMGYFRKTARRNQLLTTPMSYYSANLVAVLQLERYRIGSLALLVFPFELSVWMLLLLALLI-- 367
            .:...|    .|||..|..|.|        .:|.|      ..:.|..|..:||.|||:.||:  
  Fly   284 EVLYPY----TRRNLHLVVPAS--------AIQPE------YLIFVRVFRRTVWYLLLVTLLVVV 330

  Fly   368 -------HLGIHLPSARRGNEEDGGGGLQVVALL----LGAALARLPRSWRHRFIAAHWLWASIP 421
                   .|...:|  |||..:......:::.:.    :|....||......|.....|:..|..
  Fly   331 LVFWVMQRLQRRIP--RRGVIQFQATWYEILEMFGKTHVGEPAGRLSSFSSMRTFLMGWILFSYV 393

  Fly   422 L-------------RISYQSL------LFHL-IRLQLYNTPSFSLDQLLAEGFQGICTANTQRLL 466
            |             |.||:..      |.|| :.:....|...::...|.|...|:....:::|.
  Fly   394 LSTIYFAKLESGFVRPSYEEQVDRVDDLVHLDVHIYAVTTMYDAVRSALTEHQYGLLENRSRQLP 458

  Fly   467 LEMPQLARDPDSIQSVDTPFDWDVLNVLTRNRNRKIFAVANQDVTLSFL----HSSAHPNAFHVV 527
            |.:......|                 :.|.|:|:...:........||    .|.|...|:|:.
  Fly   459 LGIATSYYQP-----------------VVRRRDRRAAFIMRDFHARDFLAITYDSQAERPAYHIA 506

  Fly   528 KQPVNVEYAGMYMPKHSFLYEKMDDDIRRLDASGFIHAWRR 568
            ::.:........:|:.|....:::.........||...||:
  Fly   507 REYLRSMICTYILPRGSPFLHRLESLYSGFLEHGFFEHWRQ 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 24/148 (16%)
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 40/234 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463117
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.