DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7f and GluRIA

DIOPT Version :9

Sequence 1:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_476855.1 Gene:GluRIA / 38742 FlyBaseID:FBgn0004619 Length:991 Species:Drosophila melanogaster


Alignment Length:461 Identity:76/461 - (16%)
Similarity:159/461 - (34%) Gaps:136/461 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 RGSGFEIQLVEHLARRMNFSLELVNIALLRPNAY----RLAEGSSEGPIEKLLQRNVNISMGYFR 312
            |..|:...|.:.||.::....|   |.|::...|    :.|.|..:|.:.:|:::..:|::....
  Fly   507 RFEGYCKDLADMLAAQLGIKYE---IRLVQDGNYGAENQYAPGGWDGMVGELIRKEADIAISAMT 568

  Fly   313 KTARRNQLLTTPMSYYSANLVAVLQLERYRIGSLALLVFPFELSVWMLLLLALLIHLGIHL---- 373
            .||.|.:::.....:.:..:..:::....:...:...:.|....:|:.::|:   ::|:..    
  Fly   569 ITAERERVIDFSKPFMTLGISIMIKKPVKQTPGVFSFLNPLSQEIWISVILS---YVGVSFVLYF 630

  Fly   374 --------------PSARRGNEEDGG--GGLQV------------------------VALLLGAA 398
                          |.|....::..|  ||..:                        :|..:...
  Fly   631 VTRFPPYEWRIVRRPQADSTAQQPPGIIGGATLSEPQAHVPPVPPNEFTMLNSFWYSLAAFMQQG 695

  Fly   399 LARLPRSWRHRFIAAHWLWASIPLRISYQSLLFHLIRLQLYNTPSF-SLDQLLAEGFQGICTANT 462
            ....|.|...|..||.|.:.:|.|..||.:           |..:| ::::::|.          
  Fly   696 CDITPPSIAGRIAAAVWWFFTIILISSYTA-----------NLAAFLTVERMVAP---------- 739

  Fly   463 QRLLLEMPQLARDPDSIQSVDTPF-------DWDVLNVLTRNRNRKI--FAVANQDVTLSFLHSS 518
                ::.|:     |.....|..:       .|:.........:.|:  :..|||       |.|
  Fly   740 ----IKTPE-----DLTMQTDVNYGTLLYGSTWEFFRRSQIGLHNKMWEYMNANQ-------HHS 788

  Fly   519 AH--PNAFHVVKQPVNVEYAGMY-MPKHSFLYEKMDDDI----RRLDASGFIHAW-------RRA 569
            .|  ......|:|... :||.:. .||:.::..:...|.    |.:|..||..|.       :|.
  Fly   789 VHTYDEGIRRVRQSKG-KYALLVESPKNEYVNARPPCDTMKVGRNIDTKGFGVATPIGSPLRKRL 852

  Fly   570 SFASVHRKEQVHM--------------------TSRRYINHAKLSGIYMVMAGLYLLAGLLFAGE 614
            :.|.:..||...:                    ::...::.:.::|||.::.|..|||.::...|
  Fly   853 NEAVLTLKENGELLRIRNKWWFDKTECNLDQETSTPNELSLSNVAGIYYILIGGLLLAVIVAIME 917

  Fly   615 VLLRQR 620
            ...|.:
  Fly   918 FFCRNK 923

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 18/109 (17%)
GluRIANP_476855.1 PBP1_iGluR_AMPA 41..453 CDD:107375
ANF_receptor 53..434 CDD:279440
PBP2_iGluR_AMPA 477..879 CDD:270433 67/415 (16%)
Lig_chan 612..907 CDD:278489 53/335 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462564
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.