DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7f and gria3b

DIOPT Version :9

Sequence 1:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_938174.1 Gene:gria3b / 368416 ZFINID:ZDB-GENE-030616-53 Length:883 Species:Danio rerio


Alignment Length:281 Identity:48/281 - (17%)
Similarity:108/281 - (38%) Gaps:50/281 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 VNTFDGRKWKASQMFPDKLSQMHGCPLTVLTWHQPPFVELVWDPKHNRSRGS----GFEIQLVEH 263
            ||..|       |.|.:..|.:....:.|.|..:.|:|  ::...|....|:    |:.:.|...
Zfish   396 VNIMD-------QQFTNDSSSVENRTIVVTTIMEAPYV--MYKKNHMHLEGNEKYEGYCVDLASE 451

  Fly   264 LARRMNFSLELVNIALLRPNAYRLAEGSSE---GPIEKLLQRNVNISMGYFRKTARRNQLLTTPM 325
            :|:.:.....|   :::....|...:..::   |.:.:|:....:|::.....|..|.:::....
Zfish   452 IAKHVGIKYRL---SIVMDGKYGARDPETKSWNGMVGELVYGRADIAVAPLTITLVREEVIDFSK 513

  Fly   326 SYYSANL-VAVLQLERYRIGSLALLVFPFELSVWMLLLLALLIHLGIHL---------PSARRGN 380
            .:.|..: :.:.:.::.:.|..:.| .|....:||.::.|   ::|:.:         |...:.:
Zfish   514 PFMSLGISIMIKKPQKSKPGVFSFL-DPLAYEIWMCIVFA---YIGVSVVLFLVSRFSPYEWQLD 574

  Fly   381 EED-------------GGGGLQVVALLLGAALAR----LPRSWRHRFIAAHWLWASIPLRISYQS 428
            |.|             ..|....:...|||.:.:    .|||...|.:...|.:.::.:..||.:
Zfish   575 ETDEVKDPQTPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTA 639

  Fly   429 LLFHLIRLQLYNTPSFSLDQL 449
            .|...:.::...:|..|.:.|
Zfish   640 NLAAFLTVERMVSPIESAEDL 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 20/134 (15%)
gria3bNP_938174.1 Periplasmic_Binding_Protein_Type_1 25..396 CDD:299141 48/281 (17%)
ANF_receptor 36..379 CDD:279440
PBP2_iGluR_AMPA 412..794 CDD:270433 42/258 (16%)
Lig_chan 544..824 CDD:278489 22/120 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.