DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7f and clumsy

DIOPT Version :9

Sequence 1:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_001036373.1 Gene:clumsy / 35394 FlyBaseID:FBgn0026255 Length:1002 Species:Drosophila melanogaster


Alignment Length:430 Identity:77/430 - (17%)
Similarity:139/430 - (32%) Gaps:138/430 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 PVNTFD------GRKWKASQMFPDK---LSQMHGCPLTVLTWHQPPFVELVWDPKHNRSRGSGFE 257
            |||..|      ..:.:..|...:|   :|...|.|.  ||..:|...|::    ...||..|:.
  Fly   391 PVNGLDVLNDDEESEKRVGQKLSNKTFIVSSRLGAPF--LTLREPQEGEIL----TGNSRYEGYS 449

  Fly   258 IQLVEHLARRMNFSLELVNIALLRPN----AYRLAEGSSEGPIEKLLQRNVNISMGYFRKTARRN 318
            |.|:..:|:.:||..|.    .:.|:    |......:.:|.:.:|:..|.::.:.....|:.|.
  Fly   450 IDLINEIAKMLNFKFEF----RMSPDGKYGALNKVTQTWDGIVRQLIDGNADLGICDLTMTSSRR 510

  Fly   319 QLLTTPMSYYSANLVAVLQLERYRIGSLALLVFPFELSVWMLLLLALLIHLGIHLPSARRGNEED 383
            |.:.....:.:..:..:..........|...:.||.|.||:.:                      
  Fly   511 QAVDFTPPFMTLGISILFSKPPTPPTDLFSFLSPFSLDVWIYM---------------------- 553

  Fly   384 GGGGLQVVALLLGAALARL-PRSWRHRFIA-----AHWLWASIPLRISYQSLLFHLIRLQLYNTP 442
             |.....::||| .||||: |..|.:....     ...:|:                   :.||.
  Fly   554 -GSAYLFISLLL-FALARMAPDDWENPHPCKEPEEVENIWS-------------------IMNTT 597

  Fly   443 SFSLDQLLAEGFQGICTANTQRLLLEMPQLARDPDSIQSVDTPFDW-----DVLNVLTRNRNRKI 502
            ..|:..|:.:|...:..|.:.||:..|                  |     .:||..|.|     
  Fly   598 WLSIGSLMGQGCDILPKAASTRLVTGM------------------WWFFALMMLNSYTAN----- 639

  Fly   503 FAVANQDVTLSFLHSSAHPNAFHVVKQ---PVNVEYA--------GMYMPKHSFLYEKM------ 550
                    ..:||.:|...|:.:..:.   ...::|.        |.:...:...|:||      
  Fly   640 --------LAAFLTNSRQANSINSAEDLAAQSKIKYGAMAGGSTMGFFRDSNFSTYQKMWTAMES 696

  Fly   551 ----------DDDIRRLDASGFIHAWRRASFA---SVHRK 577
                      |:.:.|:.....::|:...|..   :|.||
  Fly   697 ASPSVFTKTNDEGVERVQKGKNLYAFLMESTTLEYNVERK 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 25/130 (19%)
clumsyNP_001036373.1 PBP1_iGluR_Kainate 26..396 CDD:107377 3/4 (75%)
ANF_receptor 39..379 CDD:279440
PBP2_iGluR_Kainate 414..787 CDD:270432 72/407 (18%)
Lig_chan 548..812 CDD:278489 43/263 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462674
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.