DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7f and Gria3

DIOPT Version :9

Sequence 1:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_001106213.1 Gene:Gria3 / 29628 RGDID:70958 Length:888 Species:Rattus norvegicus


Alignment Length:311 Identity:56/311 - (18%)
Similarity:116/311 - (37%) Gaps:71/311 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 YTADACQKAYPIPVNTFDGRK---WK--------ASQMFPDKLSQMHGCPLTVLTWHQPPFVELV 243
            ||.|    .|.:.|:  ..||   |.        :.|...:..|......:.|.|..:.|:|  :
  Rat   375 YTID----VYEMKVS--GSRKAGYWNEYERFVPFSDQQISNDSSSSENRTIVVTTILESPYV--M 431

  Fly   244 WDPKHNRSRGS----GFEIQLVEHLAR--RMNFSLELVNIALLRPNAYRLAEGSSE---GPIEKL 299
            :...|.:..|:    |:.:.|...:|:  |:.:.|.:|.     ...|...:..::   |.:.:|
  Rat   432 YKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVG-----DGKYGARDPETKIWNGMVGEL 491

  Fly   300 LQRNVNISMGYFRKTARRNQLLTTPMSYYSANL-VAVLQLERYRIGSLALLVFPFELSVWMLLLL 363
            :....:|::.....|..|.:::.....:.|..: :.:.:.::.:.|..:.| .|....:||.::.
  Rat   492 VYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL-DPLAYEIWMCIVF 555

  Fly   364 ALLIHLGI---------------HLPSARRGNEE-----------DGGGGLQVVALLLGAALAR- 401
            |   ::|:               ||..   .|||           :..|....:...|||.:.: 
  Rat   556 A---YIGVSVVLFLVSRFSPYEWHLED---NNEEPRDPQSPPDPPNEFGIFNSLWFSLGAFMQQG 614

  Fly   402 ---LPRSWRHRFIAAHWLWASIPLRISYQSLLFHLIRLQLYNTPSFSLDQL 449
               .|||...|.:...|.:.::.:..||.:.|...:.::...:|..|.:.|
  Rat   615 CDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 22/136 (16%)
Gria3NP_001106213.1 PBP1_iGluR_AMPA_GluR3 29..400 CDD:107382 8/30 (27%)
ANF_receptor 40..383 CDD:279440 4/11 (36%)
PBP2_iGluR_AMPA 416..799 CDD:270433 46/264 (17%)
Glutamate binding 502..504 0/1 (0%)
Lig_chan 548..829 CDD:278489 24/124 (19%)
Glutamate binding 680..681
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.