DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7f and GRIK3

DIOPT Version :9

Sequence 1:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_000822.2 Gene:GRIK3 / 2899 HGNCID:4581 Length:919 Species:Homo sapiens


Alignment Length:463 Identity:87/463 - (18%)
Similarity:168/463 - (36%) Gaps:99/463 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 PDKLSQMHGCPLTVLTWHQPPFVELVWDPK--HNRSRGSGFEIQLVEHLARRMNFSLELVNIALL 280
            |:....:....|.|.|..:.|||......:  :...|..|:.|.|::.||..:.||.|   |.|:
Human   425 PNVTDSLTNRSLIVTTVLEEPFVMFRKSDRTLYGNDRFEGYCIDLLKELAHILGFSYE---IRLV 486

  Fly   281 RPNAYRLAE--GSSEGPIEKLLQRNVNISMGYFRKTARRNQLLTTPMSYYSANLVAVLQLERYRI 343
            ....|...:  |...|.:::|:....::::.....|..|.:.:.....:.:..:..:.:......
Human   487 EDGKYGAQDDKGQWNGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGVSILYRKPNGTN 551

  Fly   344 GSLALLVFPFELSVWMLLLLALLIHLGIH---LPSARRGNEE--DG---GGGLQVV----ALL-- 394
            .|:...:.|....:||.:|||   :||:.   ...||....|  |.   ..|.:||    .||  
Human   552 PSVFSFLNPLSPDIWMYVLLA---YLGVSCVLFVIARFSPYEWYDAHPCNPGSEVVENNFTLLNS 613

  Fly   395 ----LGAALAR----LPRSWRHRFIAAHWLWASIPLRISYQSLLFHLIRLQLYNTPSFSLDQLLA 451
                :|:.:.:    :|::...|.|...|.:.::.:..||.:.|...:.::...:|..|.|.|  
Human   614 FWFGMGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDL-- 676

  Fly   452 EGFQGICTANTQRLLLEMPQLARDPDSI----QSVDTPFD--WDVL----NVLTRNRNRKIFAVA 506
                      .::..:|...: :|..::    :|..:.|:  |..:    :.|.:|....|....
Human   677 ----------AKQTKIEYGAV-KDGATMTFFKKSKISTFEKMWAFMSSKPSALVKNNEEGIQRAL 730

  Fly   507 NQDVTLSFLHSSAHPNAFHVVKQPVNVEYA-------------------GMYMPKHSFLYEKMDD 552
            ..|..|              :.:...:||.                   |:..|..|...:|:..
Human   731 TADYAL--------------LMESTTIEYVTQRNCNLTQIGGLIDSKGYGIGTPMGSPYRDKITI 781

  Fly   553 DIRRLDASGFIHA-----WRRASFASVHRKEQVHMTSRRYINHAKLSGIYMVMAGLYLLAGLLFA 612
            .|.:|.....:|.     ||.:.......||      ...:...|:.||::|:|...:|:.|:..
Human   782 AILQLQEEDKLHIMKEKWWRGSGCPEEENKE------ASALGIQKIGGIFIVLAAGLVLSVLVAV 840

  Fly   613 GEVLLRQR 620
            ||.:.:.|
Human   841 GEFVYKLR 848

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 24/130 (18%)
GRIK3NP_000822.2 PBP1_iGluR_Kainate_GluR5_7 34..417 CDD:107388
ANF_receptor 55..398 CDD:279440
PBP2_iGluR_Kainate_GluR7 433..801 CDD:270441 72/400 (18%)
Lig_chan 564..832 CDD:278489 56/303 (18%)
Glutamate binding. /evidence=ECO:0000250 690..692 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.