DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7f and GRIA3

DIOPT Version :9

Sequence 1:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_000819.4 Gene:GRIA3 / 2892 HGNCID:4573 Length:894 Species:Homo sapiens


Alignment Length:311 Identity:55/311 - (17%)
Similarity:116/311 - (37%) Gaps:71/311 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 YTADACQKAYPIPVNTFDGRK---WK--------ASQMFPDKLSQMHGCPLTVLTWHQPPFVELV 243
            ||.|    .|.:.|:  ..||   |.        :.|...:..:......:.|.|..:.|:|  :
Human   381 YTID----VYEMKVS--GSRKAGYWNEYERFVPFSDQQISNDSASSENRTIVVTTILESPYV--M 437

  Fly   244 WDPKHNRSRGS----GFEIQLVEHLAR--RMNFSLELVNIALLRPNAYRLAEGSSE---GPIEKL 299
            :...|.:..|:    |:.:.|...:|:  |:.:.|.:|.     ...|...:..::   |.:.:|
Human   438 YKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVG-----DGKYGARDPETKIWNGMVGEL 497

  Fly   300 LQRNVNISMGYFRKTARRNQLLTTPMSYYSANL-VAVLQLERYRIGSLALLVFPFELSVWMLLLL 363
            :....:|::.....|..|.:::.....:.|..: :.:.:.::.:.|..:.| .|....:||.::.
Human   498 VYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL-DPLAYEIWMCIVF 561

  Fly   364 ALLIHLGI---------------HLPSARRGNEE-----------DGGGGLQVVALLLGAALAR- 401
            |   ::|:               ||..   .|||           :..|....:...|||.:.: 
Human   562 A---YIGVSVVLFLVSRFSPYEWHLED---NNEEPRDPQSPPDPPNEFGIFNSLWFSLGAFMQQG 620

  Fly   402 ---LPRSWRHRFIAAHWLWASIPLRISYQSLLFHLIRLQLYNTPSFSLDQL 449
               .|||...|.:...|.:.::.:..||.:.|...:.::...:|..|.:.|
Human   621 CDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 22/136 (16%)
GRIA3NP_000819.4 PBP1_iGluR_AMPA_GluR3 35..409 CDD:380610 8/33 (24%)
PBP2_iGluR_AMPA 422..805 CDD:270433 46/264 (17%)
Glutamate binding. /evidence=ECO:0000250 508..510 0/1 (0%)
Glutamate binding. /evidence=ECO:0000250 686..687
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.