DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7f and Ir52c

DIOPT Version :9

Sequence 1:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_725470.1 Gene:Ir52c / 246630 FlyBaseID:FBgn0050468 Length:599 Species:Drosophila melanogaster


Alignment Length:250 Identity:54/250 - (21%)
Similarity:103/250 - (41%) Gaps:46/250 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LVIENVLAQLSTTLVVTISTRHLGTAHWFEYMMNILMDSWRMVAVQ-----LLRIRPDLVVNPVP 107
            ::|...|...|:.::...:..||.    |:|.:..|:   :.:.|:     ||....|..:..:.
  Fly     5 IIILFCLGNSSSQILDVTNNSHLD----FDYRLFGLL---QRLQVEKSYDTLLVYGEDCAIPSLF 62

  Fly   108 GRKRVSLLMVDSYQGLLDTNITA----SNANFDD---PDYYFIF-LQARDHLIPKELQLILDH-- 162
            .|.:|..::|.|.....|.|.::    .:.||.|   .:|..:. ||....||     |:..|  
  Fly    63 ERLQVPAVLVSSGSTNFDWNFSSLTLILSCNFQDEREENYRTLMKLQTSRRLI-----LLKGHIK 122

  Fly   163 --CLAHFW----LHCNVMIQT--AQVEVLVYTYYPYTADACQKAYPIPVNTFDGRKWKASQMFPD 219
              .:..|:    .|...|::.  .|:|| ||:...:.....:|     :|.|||:     .::.|
  Fly   123 PESVCDFYSKKEQHNVAMVKENFYQLEV-VYSCRLFQDQNYEK-----LNLFDGK-----SIYKD 176

  Fly   220 KLSQMHGCPLTVLTWHQPPFVELVWDPKHNRSRGSGFEIQLVEHLARRMNFSLEL 274
            :...|||.|:..|:..:||......|.|....:..|:...|:....:::|.::::
  Fly   177 QFRNMHGAPIRTLSDKEPPRTIPYIDSKTGEEKFKGYVGMLISQFVKKVNATMQI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 8/43 (19%)
Ir52cNP_725470.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.