DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7f and ZK867.2

DIOPT Version :9

Sequence 1:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_001355384.1 Gene:ZK867.2 / 191445 WormBaseID:WBGene00022829 Length:354 Species:Caenorhabditis elegans


Alignment Length:284 Identity:57/284 - (20%)
Similarity:94/284 - (33%) Gaps:103/284 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 NVMIQTAQVEVLVYTYYPYTADACQKAYPIP---------VNTFDGRKWKASQMFPDKLSQMHGC 227
            ::.|...:.||::::|.....:...:::|:.         :.||     ..||::...:......
 Worm    87 SMRIAPEREEVVLFSYPTRVFETSIQSFPVSSRMLLLIILIATF-----FISQLYQTDMLAFLSV 146

  Fly   228 PLTVLTWHQPPF------VELVWDPKHNRSRGSGFEIQLV---------------EHLARRMNFS 271
            |||    :..||      :|||   :|.:...:.||.|.:               ::..||.|..
 Worm   147 PLT----YSIPFRSIKQALELV---EHQKMYIAAFENQTLLCTPTTCSLFQKSIDKNPVRRANKD 204

  Fly   272 LEL-------------VNIALL--------------------RPNAYRLAEGSSEGPIEKLLQR- 302
            .|:             |:.|||                    .|:.|.....|.:.  :|||:: 
 Worm   205 TEVQDLIKKGGIYQSTVDSALLPGQLSWLNVDQKFLIVRDEDAPSYYVAFTFSKKH--KKLLKKF 267

  Fly   303 ------------NVNISMGYFRKTARRNQLLTTPMSYYSANLVAVLQLER--YRIGSLALLVFPF 353
                        .:.|..||..|........|.|.|..|.| ..:.||.|  ..|.|:.|.||..
 Worm   268 NSALIEVLPAVSLITIGHGYNTKKKPFEIRTTNPRSSLSIN-NHLWQLFRSFIIISSICLFVFGL 331

  Fly   354 ELSVWMLLLLALLIHLGIHLPSAR 377
            |          :|.|...|..|::
 Worm   332 E----------ILFHFLFHFRSSK 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 41/195 (21%)
ZK867.2NP_001355384.1 Lig_chan-Glu_bd 22..77 CDD:214911
Periplasmic_Binding_Protein_Type_2 <69..>103 CDD:389745 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.