DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7f and Grid2

DIOPT Version :9

Sequence 1:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_032193.1 Gene:Grid2 / 14804 MGIID:95813 Length:1007 Species:Mus musculus


Alignment Length:485 Identity:100/485 - (20%)
Similarity:182/485 - (37%) Gaps:146/485 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 PVNTFDGRKWKASQMFPDKL-SQMHGCPLTVLTWHQPPFV----ELVWDPKHNRSRGSGFEIQLV 261
            ||...:|      .:...|| :.|.|..|.|:|..:.|||    .::..||    :..||.|.::
Mouse   421 PVTGLNG------SLTDKKLENNMRGVVLRVVTVLEEPFVMVSENVLGKPK----KYQGFSIDVL 475

  Fly   262 EHLARRMNFSLELVNIALLRPNAYRLAEGSSEGPIEKLLQRNVNISMGYFRKTARRNQLLTTPMS 326
            :.|:..:.|:.| :.:|..........:|:..|.:.:|:.:..:|.:.....|..|..::.....
Mouse   476 DALSNYLGFNYE-IYVAPDHKYGSPQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTR 539

  Fly   327 YYSANLVAVLQLERYRIGSLALLVFPFELSVW-----MLLLLALLIHL--GIHLPSARRGNEE-- 382
            |...::..:|:.....:...|.|. ||:||:|     .:||:.||::|  .::.|..:.|:..  
Mouse   540 YMDYSVGVLLRRAEKTVDMFACLA-PFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSMTST 603

  Fly   383 --------------DGGGGLQVVAL----LLGAALARLPRSWRHRFIAAHWLWASIPL------- 422
                          ..||.:....|    ::||        |        ||:|.|.:       
Mouse   604 TLYNSMWFVYGSFVQQGGEVPYTTLATRMMMGA--------W--------WLFALIVISSYTANL 652

  Fly   423 -------RI--SYQSL------------------LFHLIRLQLYNTPSFSLDQLLAEGFQGICTA 460
                   ||  |.|||                  ::..:|::..|  .|..|.:.::.::.|..:
Mouse   653 AAFLTITRIESSIQSLQDLSKQTDIPYGTVLDSAVYQHVRMKGLN--PFERDSMYSQMWRMINRS 715

  Fly   461 N-TQRLLLEMPQLARDPDSIQSV---DTPFDWD--VLNVLTRNRNRKIF-----AVANQDVTLSF 514
            | ::..:||      ....||.|   :..|.||  ||..:..|.....|     .||::...::.
Mouse   716 NGSENNVLE------SQAGIQKVKYGNYAFVWDAAVLEYVAINDPDCSFYTVGNTVADRGYGIAL 774

  Fly   515 LHSSAHPNAFHVVKQPVNVEYAG-MYMPKHSF--------LYEKMDD-------DIRRLD----- 558
            .|.|.:.:.|.  ::.:.::.:| |.:.||.:        ||..:|.       ||:.|.     
Mouse   775 QHGSPYRDVFS--QRILELQQSGDMDILKHKWWPKNGQCDLYSSVDAKQKGGALDIKSLAGVFCI 837

  Fly   559 -ASGFIHA---------WRRASFASVHRKE 578
             |:|.:.:         |.|...:.|..||
Mouse   838 LAAGIVLSCLIAVLETWWSRRKGSRVPSKE 867

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 28/130 (22%)
Grid2NP_032193.1 Interaction with CBLN1 homotrimer. /evidence=ECO:0000250|UniProtKB:O43424 24..345
Periplasmic_Binding_Protein_type1 28..429 CDD:385651 3/13 (23%)
PBP2_iGluR_delta_2 440..806 CDD:270449 81/397 (20%)
Interaction with AP4M1. /evidence=ECO:0000250|UniProtKB:Q63226 921..991
PDZ-binding 1005..1007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.