DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7f and si:dkey-183j2.10

DIOPT Version :9

Sequence 1:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster
Sequence 2:XP_001923977.1 Gene:si:dkey-183j2.10 / 100151589 ZFINID:ZDB-GENE-130530-729 Length:465 Species:Danio rerio


Alignment Length:438 Identity:74/438 - (16%)
Similarity:142/438 - (32%) Gaps:159/438 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 LTVLTWHQPPFVELVWDPKHNRSRGS---GFEIQLVEHLARRMNFSLELVNIALLRPNAYRLAE- 289
            |.|.|..|.|:         ..|:||   |:.:.|:..||:::.|..:   :.|::..:|...: 
Zfish    31 LIVTTIKQDPY---------TMSKGSQLEGYCMDLLTELAKKLGFKYK---VHLVKDGSYGRQDE 83

  Fly   290 -GSSEGPIEKLLQRNVNISMGYFRKTARRNQLLTTPMSYYSANLVAVLQ--LERYRIGSLALLVF 351
             |:..|.|.::::...::::.....||.|.:.:.....|....:..:|:  :.....|....| .
Zfish    84 NGNWNGMIGEVVRGEADLAVAPLTLTAAREKAVGMTKPYMQTGISILLRKDIVSEEAGFFDFL-S 147

  Fly   352 PFELSVWMLLLLALLIHLGIHLPSARRGNEEDGGGGLQVVALLLGAALARLPRSWR------HRF 410
            ||....|..:|:|..:                     ..|.:.:...|:  |..|.      :.|
Zfish   148 PFSGETWFGILIAYFV---------------------TAVCICIVGRLS--PCEWSQPETEPNHF 189

  Fly   411 IAAHWLW---ASIPLR-------------ISYQSLLFHLIRLQLY-----NTPSFSLDQLLAEGF 454
            ...|.||   .::.|:             ||....||.::.|..|     :|.......|:.:||
Zfish   190 TLLHSLWYTAGALSLQGAGPHPKAVSGRVISCTWWLFAVVLLACYFSSLSSTQGSDSAPLMIKGF 254

  Fly   455 QGICTANTQRLLLEMPQLARDPDSIQSVDTPFDWDVLNVLTRNRNRKIFAVANQDV--------- 510
            :.:                                                |||||         
Zfish   255 EDL------------------------------------------------ANQDVIEYGTLAGS 271

  Fly   511 -TLSFLHSSAHPNAFHVVKQPVNVEYAGMY--MPKHSFLYEKMDDDIRRLDASGFIHAWRRASFA 572
             ||:|..:|.:|:            |..:|  |.:.......||:.:::.         :..::|
Zfish   272 STLAFFKNSNNPS------------YRRIYEHMERRKSFVSSMDEGVQKA---------KEGNYA 315

  Fly   573 SVHRKEQVHMTSRRYINHAKLSGIYMV--MAGLYLLAGLLFAGEVLLR 618
            .:.....:.:...|   |.:|...:.|  |.|..::..|   |..:|:
Zfish   316 FIGESVSLDLAVAR---HCELVRAHEVIGMRGYSIVTPL---GSAMLK 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 26/133 (20%)
si:dkey-183j2.10XP_001923977.1 PBP2_iGluR_non_NMDA_like 28..381 CDD:270403 74/438 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.