DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7e and Gria3

DIOPT Version :9

Sequence 1:NP_001138176.1 Gene:Ir7e / 7354417 FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_001268858.2 Gene:Gria3 / 53623 MGIID:95810 Length:888 Species:Mus musculus


Alignment Length:180 Identity:40/180 - (22%)
Similarity:64/180 - (35%) Gaps:46/180 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   423 LVQKNFT-VVLTPIV---------QEVLDEIPSVQHMRFRLLEANSELDPLYFLEANHQLRQHVT 477
            |....|| :||..::         |.|.:|.|.||    :.::....||...|.||.:...::.:
Mouse   241 LANLGFTDIVLERVMHGGANITGFQIVNNENPMVQ----QFIQRWVRLDEREFPEAKNAPLKYTS 301

  Fly   478 ASALD-------IFIHFNRLSADKVHQRGEQGSGAHFEIVP-------EDIISM----------Q 518
            |...|       .|.:..|...| |.:||..|.......||       |..:.|          |
Mouse   302 ALTHDAILVIAEAFRYLRRQRVD-VSRRGSAGDCLANPAVPWSQGIDIERALKMVQVQGMTGNIQ 365

  Fly   519 LTMYLAKHSFLIDQLNEEIMWMRSVGLLSVWSRWE----LSESYLRNEQS 564
            ...|..:.::.||....::...|..|   .|:.:|    .|:..:.|:.|
Mouse   366 FDTYGRRTNYTIDVYEMKVSGSRKAG---YWNEYERFVPFSDQQISNDSS 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497
Gria3NP_001268858.2 PBP1_iGluR_AMPA_GluR3 29..403 CDD:380610 37/169 (22%)
PBP2_iGluR_AMPA 416..799 CDD:270433
Glutamate binding 502..504
Glutamate binding 680..681
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.