DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7e and GluRIB

DIOPT Version :9

Sequence 1:NP_001138176.1 Gene:Ir7e / 7354417 FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_001261621.2 Gene:GluRIB / 44484 FlyBaseID:FBgn0264000 Length:1182 Species:Drosophila melanogaster


Alignment Length:259 Identity:57/259 - (22%)
Similarity:98/259 - (37%) Gaps:48/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 FWLNLELVFVGMPLLECPRSHTARLYCVMLMMYTLIIRTIYQGLLYHLIRTHQLNRWPQTIESLV 424
            ||.:| ..|:.......|||.:.|:.......:|||:.:.|...|...:          |:|.:|
  Fly   743 FWFSL-AAFMQQGCDLSPRSVSGRIAAASWFFFTLILISSYTANLAAFL----------TVERMV 796

  Fly   425 QKNFTVVLTPIVQEVLDEIPSVQHMRFRLLEANSELDPLYFLEANHQL----------RQHVTAS 479
                    |||...  :::.....:::..|...|..|  :|..:...|          |:||...
  Fly   797 --------TPINSP--EDLAMQTEVQYGTLLHGSTWD--FFRRSQIGLHNKMWEYMNSRKHVFVP 849

  Fly   480 ALDIFIHFNRLSADKVHQRGEQGSGAHFEIVPEDIISMQLTMYLAKHSF---------LIDQLNE 535
            ..|..|...|.|..|.....|.....:.. ..|...:|::...|....|         |.|.:|.
  Fly   850 TYDEGIKRVRNSKGKYALLVESPKNEYVN-AREPCDTMKVGRNLDTKGFGIATPLGSALKDPINL 913

  Fly   536 EIMWMRSVG-LLSVWSRW--ELSE--SYLRNEQSFQVLGTMELYAIFLMVLVGLIVGLLVFILE 594
            .::.::..| |:.:.::|  |.:|  ::...|.|...|....:..||.:::.||:|.:.|.|||
  Fly   914 AVLTLKENGELIKLRNKWWYEKAECSTHKDGETSHSELSLSNVAGIFYILIGGLLVSVFVAILE 977

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497
GluRIBNP_001261621.2 PBP1_iGluR_AMPA 43..478 CDD:107375
ANF_receptor 55..461 CDD:279440
PBP2_iGluR_AMPA 497..938 CDD:270433 44/218 (20%)
Lig_chan 632..967 CDD:278489 50/247 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462550
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.