DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7e and GluRIID

DIOPT Version :9

Sequence 1:NP_001138176.1 Gene:Ir7e / 7354417 FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_651982.1 Gene:GluRIID / 44483 FlyBaseID:FBgn0028422 Length:902 Species:Drosophila melanogaster


Alignment Length:443 Identity:91/443 - (20%)
Similarity:171/443 - (38%) Gaps:110/443 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 PFLTLDEDQEEVLRVN--GGYEGRLLLALAEKMNFTIAVR---------KVHVNMRDEALEMLRR 274
            |:.:|.|..:.::..|  .||...|:..||:|:.|....|         ....|.....|:.:..
  Fly   430 PYASLVESIDTLIGNNQFQGYGVDLIKELADKLGFNFTFRDGGNDYGSFNKTTNSTSGMLKEIVE 494

  Fly   275 DEVDLTLGGIRQTVARGMVATSSHNYHQTREVFGVLASSY--------ELSSFDILFYPYRLQIW 331
            ...||.:..:..|..|..|...|..:..    .|: |..|        .|.||   ..|:..::|
  Fly   495 GRADLAITDLTITSEREEVIDFSIPFMN----LGI-AILYVKPQKAPPALFSF---MDPFSSEVW 551

  Fly   332 MGILGVVALS-ALIQLIVGRML-------------RERMGSRFWLNLELVFVGMPLLE-----CP 377
            : .||:..|. :|...|:||:.             .|.:.::|.:|..|.|....||:     .|
  Fly   552 L-YLGIAYLGVSLCFFIIGRLSPIEWDNPYPCIEEPEELENQFTINNSLWFTTGALLQQGSEIAP 615

  Fly   378 RSHTARLYCVMLMMYTLIIRTIYQGLLYHLIRTHQLNRWPQTIESLVQKNFTVVLTPI--VQEVL 440
            ::.:.|....:...:|||:.:.|...|...:          |||:        ..:||  |:::.
  Fly   616 KALSTRTISAIWWFFTLIMVSSYTANLAAFL----------TIEN--------PTSPINSVKDLA 662

  Fly   441 DEIPSVQHMRFRL-----LEANSELDPLYFLEANHQLRQHVTASALDIFIHFNRLSADKVHQRGE 500
            |....||:...|.     ..:.|| :|:| ::.|..|..|.     ::.:..|:...|||.    
  Fly   663 DNKDDVQYGAKRTGSTRNFFSTSE-EPIY-IKMNEYLNAHP-----EMLMENNQQGVDKVK---- 716

  Fly   501 QGSGAHFEIVPED-------IISMQLT------------MYLAKHSFLIDQLNEEIMWMRSVGLL 546
              ||..:..:.|.       :....||            :.:.|:....|:.|:.::.::..|:|
  Fly   717 --SGTKYAFLMESTSIEFNTVRECNLTKVGDPLDEKGYGIAMVKNWPYRDKFNKALLELQEQGVL 779

  Fly   547 S-VWSRW--ELSE---SYLRNEQSFQVLGTMELYAIFLMVLVGLIVGLLVFIL 593
            : :.::|  |:..   |...::.....||...|..|::::::|.|:.:::.||
  Fly   780 ARLKNKWWNEVGAGVCSAKSDDDGPSELGVDNLSGIYVVLVIGSIISIIISIL 832

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497 22/102 (22%)
GluRIIDNP_651982.1 PBP1_iGluR_Kainate 35..397 CDD:107377
ANF_receptor 46..380 CDD:279440
PBP2_iGluR_Kainate 417..788 CDD:270432 81/397 (20%)
Lig_chan 549..819 CDD:278489 60/301 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462847
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.