DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7e and Ir94g

DIOPT Version :9

Sequence 1:NP_001138176.1 Gene:Ir7e / 7354417 FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_651147.2 Gene:Ir94g / 42768 FlyBaseID:FBgn0039079 Length:545 Species:Drosophila melanogaster


Alignment Length:518 Identity:95/518 - (18%)
Similarity:186/518 - (35%) Gaps:137/518 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 LQARDRLLQGEMRLIFDYCWRYRLIHCSIQVQKSNGDILFYSYYPFGEHGCSDMEP----QLINR 188
            :|.||..|..|   :..:|....:|:.:          ..:..:|..|: .|..|.    :::|:
  Fly   104 MQDRDEFLVSE---VLQFCLSQDMINVN----------AIFDDFPETEN-LSSFEAYPSFEVVNQ 154

  Fly   189 YNGSMLVEPDLFPRKLRNFFGCPLRCALWDVPPFLTLDEDQE---EVLRVNGGYEGRLLLALAEK 250
            .........||:|.|:.|..|..:|.......|...|.:|:|   |:|    ||...||.|.|.|
  Fly   155 TFTPDTQVSDLYPNKMLNLRGGVIRTMPDYSEPNTILYQDKEGNKEIL----GYLWDLLEAYAHK 215

  Fly   251 MNFTIAVRKVHVNMRD----EALEMLRRDEVDLTLGGIRQTVARGMVATSSHNYHQTREVFGVLA 311
            .|..:.|...:.:.|.    |.|:..:...:|  :|...|.::                 .|.|:
  Fly   216 HNAQLQVVNKYADDRPLNFIELLDAAQSGIID--VGASIQPMS-----------------MGSLS 261

  Fly   312 SSYELSSFDILFYPYRLQIWMGILGVVALSALIQLIVGRMLRERMGSRFWLNLELVFVGMPLLEC 376
            ..:|:|      ||.....|..:|.|..     ||.|..:|...:.......|.|:::...:|..
  Fly   262 RMHEMS------YPVNQASWCTMLPVER-----QLHVSELLTRVIPYPTLALLLLLWIFYEVLRG 315

  Fly   377 PRSHTARLYCVMLMMYTLIIRTIYQGLLYHLIRTHQLNRWPQTIESLVQKNFT--VVLTPIVQEV 439
            .....:||..:..::...::.:.|.|.|.:|                    ||  ..|.|:    
  Fly   316 RWRRHSRLQSIGWLVLATLVSSNYVGKLLNL--------------------FTDPPSLPPV---- 356

  Fly   440 LDEIPSVQHMRFRLLEANSELDPLYFLEANHQLRQHVTASALDIFIH----------FN-----R 489
             :.:.::.....|::...||...:.|.:....      ::|..:.:|          ||     .
  Fly   357 -NSLAALMESPVRIISIRSEYSAIEFTQRTKY------SAAFHLALHASILIGLRNAFNTSYGYT 414

  Fly   490 LSAD--KVHQRGEQGSG----------AHFEIVPEDIISMQLTMYLAK-HSFLIDQLNEEIMWMR 541
            ::::  |:::..::.|.          ..:|::|..::..:.:.:.|. ||:        .:.:|
  Fly   415 ITSEKWKIYEEQQKRSSKPVFRYSKDLCFYEMIPFGLVIPENSPHRAPLHSY--------TLLLR 471

  Fly   542 SVGLLSVWSRWELSESYLRNEQSFQVLG---------TMELYAIFLMVLVGLIVGLLVFILEL 595
            ..||...|.....|......:.:|..:|         ..:|..:|::.:..|::.|::|..||
  Fly   472 QAGLHDFWVNRGFSYMVKAGKINFTAVGERYEAKTLTITDLRNVFIIYVSVLLISLILFTCEL 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497 23/101 (23%)
Ir94gNP_651147.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.