DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7e and Ir93a

DIOPT Version :9

Sequence 1:NP_001138176.1 Gene:Ir7e / 7354417 FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_650924.3 Gene:Ir93a / 42471 FlyBaseID:FBgn0259215 Length:868 Species:Drosophila melanogaster


Alignment Length:460 Identity:82/460 - (17%)
Similarity:166/460 - (36%) Gaps:106/460 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 PPFLTLDEDQEEVLRVNGGYEGRLLLALAEKMNFTIAVRKVHVNMRDEALE-MLRRDEVDLTLGG 283
            ||:..|.::...|:..:.|....::..|:..:||:..:.:......:::|. ....:|.|..:|.
  Fly   443 PPWQILTKNSNGVIVEHKGIVMEIVKELSRALNFSYYLHEASAWKEEDSLSTSAGGNESDELVGS 507

  Fly   284 I--------------RQTVARGMVAT------SSHNYHQ---TREVFGVLASSYELSSFDILFYP 325
            :              .|.....:.||      ...||.|   .::...:.....|:|...:...|
  Fly   508 MTFRIPYRVVEMVQGNQFFIAAVAATVEDPDQKPFNYTQPISVQKYSFITRKPDEVSRIYLFTAP 572

  Fly   326 YRLQIWMGILGVVALSALIQLIVGRM--LRE-------RMGSRFWLNLELVFVGMPLLE-----C 376
            :.::.|..::|::.|:|.....:.|:  |:|       .:.|.||      ::...||:     .
  Fly   573 FTVETWFCLMGIILLTAPTLYAINRLAPLKEMRIVGLSTVKSCFW------YIFGALLQQGGMYL 631

  Fly   377 PRSHTARLYCVMLMMYTLIIRTIYQGLLYHLIRTHQLNRWPQTIESLVQKNFTVVLT-PIVQEVL 440
            |.:.:.||......:..:::.|.|.|                        |....|| |..|..:
  Fly   632 PTADSGRLVVGFWWIVVIVLVTTYCG------------------------NLVAFLTFPKFQPGV 672

  Fly   441 DEIPSVQHMR-------------FRLLEANSELDPLYFLEANHQLRQHVTASA----LDIFIHFN 488
            |.:..::..:             .|.:::.:..|..::||     |..:..||    ::......
  Fly   673 DYLNQLEDHKDIVQYGLRNGTFFERYVQSTTREDFKHYLE-----RAKIYGSAQEEDIEAVKRGE 732

  Fly   489 RLSAD-------KVHQRGEQGSGAHFEIVPEDIISMQLTMYLAKHSFLIDQLNEEIMWMRSVGLL 546
            |::.|       .|.:..|:....||.:..|..:..|:.|.:...|..:..:|..|..|..:|.:
  Fly   733 RINIDWRINLQLIVQRHFEREKECHFALGRESFVDEQIAMIVPAQSAYLHLVNRHIKSMFRMGFI 797

  Fly   547 SVWSRWELSESYLRNEQSFQ------VLGTMELYAIFLMVLVGLIVGLLVFILEL--VSMRSIYL 603
            ..|.:..|..:...|.:|.|      .:...::...||::|:|..:.||:...|.  ...|:...
  Fly   798 ERWHQMNLPSAGKCNGKSAQRQVTNHKVNMDDMQGCFLVLLLGFTLALLIVCGEFWYRRFRASRK 862

  Fly   604 RKLFT 608
            |:.||
  Fly   863 RRQFT 867

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497 18/116 (16%)
Ir93aNP_650924.3 Periplasmic_Binding_Protein_Type_2 429..>697 CDD:328725 45/283 (16%)
Lig_chan 576..836 CDD:306551 51/294 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462908
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.