DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7e and Ir87a

DIOPT Version :9

Sequence 1:NP_001138176.1 Gene:Ir7e / 7354417 FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster


Alignment Length:484 Identity:88/484 - (18%)
Similarity:176/484 - (36%) Gaps:115/484 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 DLFPRKLRNFFGCPLRCALWDVPPFLTLDEDQEEV------------------------------ 232
            |.|||.|.   ||||..:.....|::..:.:::.|                              
  Fly   325 DKFPRDLS---GCPLTASFRPWEPYIFRNSEEQPVDDYYYGLQGDEDDYNDTSPNYGESDDESYA 386

  Fly   233 --------------------LRVNGGYEGRLLLALAEKMNFTIAVRKVHVNMRDEALEMLRRDEV 277
                                |::: |.|..::..:||:::.:|.::..:.|:. ...:.|...|:
  Fly   387 DPGEDGDGAIPDTETQSGGKLKLS-GIEYEMVQTIAERLHVSIEMQGENSNLY-HLFQQLIDGEI 449

  Fly   278 DLTLGGIRQTVARGMVATSSHNYHQTREVFGVLASSYELSSFD-ILFYPYRLQIWMGILGVVALS 341
            ::.:|||.:..:.....:||..|||....:.|..:......|: :..:.......:||. ||..|
  Fly   450 EMIVGGIDEDPSISQFVSSSIPYHQDELTWCVARAKRRHGFFNFVATFNADAGFLIGIF-VVTCS 513

  Fly   342 ALI---QLIVGRMLRERMGSRFWLNLELVFV----GMPLLECPRSHTARLYCVMLMMYTLIIRTI 399
            .::   |.:.|..|| .:...|...|.::.:    .:|..:.|.: ..:|:.:..:|......| 
  Fly   514 LVVWLAQRVSGFQLR-NLNGYFPTCLRVLGILLNQAIPAQDFPIT-LRQLFALSFLMGFFFSNT- 575

  Fly   400 YQGLLYHLIRTHQLNRWPQTIESLVQKNFTVVLTPIVQEVLDEIPSVQHMRFRLLEANSELDPLY 464
            ||..|...:.|.:.:....|::.:.....||:.|.            :|:|    ..|.:.:...
  Fly   576 YQSFLISTLTTPRSSYQIHTLQEIYSNKMTVMGTS------------EHVR----HLNKDGEIFK 624

  Fly   465 FLEANHQL-------------RQHVTASALDIFIHFN-RLSADKVHQRGEQGSGAHFEIVPEDII 515
            ::....|:             .:|:..:.......:| |:..|:::....:          |.:.
  Fly   625 YIREKFQMCYNLVDCLNDAAQNEHIAVAVSRQHSFYNPRIQRDRLYCFDRR----------ESLY 679

  Fly   516 SMQLTMYLAKHSFLIDQLNEEIMWMRSVGLLSVWS-----RWELSESYLR-NEQSFQVLGTMELY 574
            ...:||.|.|...|:.|:|..|..:...|.:..|:     |..:.|...| .|..|:.| |.:.:
  Fly   680 VYLVTMLLPKKYHLLHQINPVIQHIIESGHMQKWARDLDMRRMIHEEITRVREDPFKAL-TFDQF 743

  Fly   575 AIFLMVLVG-LIVGLLVFILELVSMRSIY 602
            ...:....| |:|...||..||..::.:|
  Fly   744 RGAIAFSGGLLLVASCVFAFELCYVKYVY 772

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497 20/144 (14%)
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 15/68 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.