DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7e and Ir64a

DIOPT Version :9

Sequence 1:NP_001138176.1 Gene:Ir7e / 7354417 FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_647962.1 Gene:Ir64a / 38616 FlyBaseID:FBgn0035604 Length:859 Species:Drosophila melanogaster


Alignment Length:317 Identity:58/317 - (18%)
Similarity:92/317 - (29%) Gaps:125/317 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LTLCCRSNHTCNFYNKMMSTLFREWGLAPLQIVNVLRGVPWHPVPGRR---HFNVIFTDSFAAFE 107
            |||..|.:...::      |||..|.                  ||..   |.|:....||...|
  Fly   247 LTLAKRMSEAAHY------TLFDVWN------------------PGLNYGGHVNLTEIGSFTPTE 287

  Fly   108 EIRMEYYSREYNYNEHYFIFLQARDRLLQGEMRLIFDYCWRYRLIHCSIQVQKSN--GDILFYSY 170
            .|::..:.|..:         ..|.|:.....|           :.|.:.|...|  |.:::|..
  Fly   288 GIQLHTWFRTTS---------TVRRRMDMQHAR-----------VRCMVVVTNKNMTGTLMYYLT 332

  Fly   171 YPFGEHGCSDMEPQLINRYNGSMLVE-PDLFPRKLRNFFGCPLRCALWDVPPFLTLDEDQEEVLR 234
            :....|      ...:||:|.::|:. .|:|     |:.....|...|                 
  Fly   333 HTMSGH------IDTMNRFNFNLLMAVRDMF-----NWTFVLSRTTSW----------------- 369

  Fly   235 VNGGY--EGRLLLALAEKMNFTIAVRKVHVNMRDEALEMLRRDEVDLTLGGIRQTVARGMVATSS 297
               ||  .||.                      |..:..|.|:|.|:....|...:.|       
  Fly   370 ---GYVKNGRF----------------------DGMIGALIRNETDIGGAPIFYWLER------- 402

  Fly   298 HNYHQTREVFGVLASSYELSSFD----------ILFYPYRLQIWMGILGVVALSALI 344
               |:..:|.|...||.....|.          :...|:...:|:.|:|...|:..|
  Fly   403 ---HKWIDVAGRSWSSRPCFIFRHPRSTQKDRIVFLQPFTNDVWILIVGCGVLTVFI 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497 14/96 (15%)
Ir64aNP_647962.1 Periplasmic_Binding_Protein_Type_2 351..>465 CDD:304360 28/163 (17%)
Lig_chan 563..828 CDD:278489
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462941
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.