DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7e and gria3b

DIOPT Version :9

Sequence 1:NP_001138176.1 Gene:Ir7e / 7354417 FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_938174.1 Gene:gria3b / 368416 ZFINID:ZDB-GENE-030616-53 Length:883 Species:Danio rerio


Alignment Length:130 Identity:30/130 - (23%)
Similarity:59/130 - (45%) Gaps:29/130 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 IESLVQKNFTVVLTPI--------VQEVLDEIPSVQHMRFRLLEA-----NSELDPLYFLEANHQ 471
            :|:.|..|:.|....:        .:.:::|:...|..|: |::.     |..|:.:..|..|.:
Zfish   168 MEAAVANNWQVTARSVGSITDPQEFRRIIEEMDRRQEKRY-LIDCEVDRINVILEQVVTLGKNSR 231

  Fly   472 LRQHVTASALDIFIHFNRLSADKVHQRGEQGSGAHFEIV-PEDIISMQLTMYLAKHSFLIDQLNE 535
            ...::.|:     :.|..:|.|||...|...||  |:|: ||:::..|   :|.:.    |:|:|
Zfish   232 GYHYIIAN-----LGFTNISLDKVFLGGANISG--FQIINPENLVVQQ---FLQRW----DRLDE 282

  Fly   536  535
            Zfish   283  282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497
gria3bNP_938174.1 Periplasmic_Binding_Protein_Type_1 25..396 CDD:299141 30/130 (23%)
ANF_receptor 36..379 CDD:279440 30/130 (23%)
PBP2_iGluR_AMPA 412..794 CDD:270433
Lig_chan 544..824 CDD:278489
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591777
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.