DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7e and Ir10a

DIOPT Version :9

Sequence 1:NP_001138176.1 Gene:Ir7e / 7354417 FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_001096949.1 Gene:Ir10a / 32067 FlyBaseID:FBgn0083979 Length:609 Species:Drosophila melanogaster


Alignment Length:652 Identity:129/652 - (19%)
Similarity:235/652 - (36%) Gaps:187/652 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PSLVLTLCCRSNHTCNFYNKMMSTLFREWGL----APLQIVNVLRGVPWHPVP-GRRH------- 94
            |.|.|.|...|:|      :.....:.:|.|    .||.||.......|...| |||:       
  Fly    35 PQLELWLRAGSDH------QDAENPYVQWFLLRTEIPLSIVTYQENRYWMDDPFGRRNLVLVMSL 93

  Fly    95 ------------------FNVIFTD---SFAAFEEIRMEYYSREYNYNEH--YFIFLQARDRLLQ 136
                              |..|..|   ..:|.|::|:|...|:. :.:|  |..|...||.:  
  Fly    94 DQLLTNRGAAAPIQKASTFFYILADQDKDLSADEQLRLEGSCRQL-WTQHKVYNRFFLTRDGV-- 155

  Fly   137 GEMRLIFDYCWRYRLIHCSIQVQKSNGDILFYSYYPFGEHGCSDMEPQLINRYNGSMLVEPDLFP 201
                                           :.|.||...   |.....:.||.||..::..|| 
  Fly   156 -------------------------------WIYDPFKRR---DSAFGRLVRYYGSETLDKLLF- 185

  Fly   202 RKLRNFFGCPLRC----ALWDVPPFLTLDEDQEEVLRVNGGYEGRLLLALAEKMNFTIAVRKVHV 262
               |:..|.|||.    :::..|.|   |::...:.||. |.:..:...|.|::|||:.:::...
  Fly   186 ---RDMAGYPLRIQMFRSVYTRPEF---DKETGLLTRVT-GVDFLVAQMLRERLNFTMLLQQPEK 243

  Fly   263 NMRDE---------ALEMLRRDEVDLTLGG--IRQTVARGMVATSSHNYHQTREVFGVLASSYEL 316
            ....|         |:..:.:|.:|:.|.|  ::..:.:..:..:...|.....::...||....
  Fly   244 KYFGERSANGSYNGAIGSIIKDGLDICLTGFFVKDYLVQQYMDFTVAVYDDELCIYVPKASRIPQ 308

  Fly   317 SSFDILFYPYRLQIWMGILGVVALSALI------------------QLIVGRMLRERMGSRFWLN 363
            |...|....|  .||:|.:......|||                  |.|||:.|...:.:  |  
  Fly   309 SILPIFAVGY--DIWLGFVLTAFACALIWLTLRVINLKLRIVSLGNQHIVGQALGIMVDT--W-- 367

  Fly   364 LELVFVGMPLLECPRSHTARLYCVMLMMYTLIIRTIYQGLLYHLIRTHQLNRWPQTIESLVQKNF 428
              :|:|.:.|...|.|:..|::...|.:.::|...|::..|                       .
  Fly   368 --VVWVRLNLSHLPASYAERMFIGTLCLVSVIFGAIFESSL-----------------------A 407

  Fly   429 TVVLTPIVQEVLDEIPSVQHMRFRLL-EANSELDPLYFLEANHQLRQHVTASALDIFIHFNR-LS 491
            ||.:.|:..:.::.:..:.....::: :.:|..|.|:|.|.:...      ::|:..:.:|| |.
  Fly   408 TVYIHPLYYKDINTMQELDESGLKVVYKYSSMADDLFFSETSPLF------ASLNKKLSWNRDLR 466

  Fly   492 ADKVHQ----RGEQG---------SGAHFE------IVPEDIISMQLTMYLAKHSFLIDQLNEEI 537
            ||.:.:    |.:.|         ..:||.      :|||......::..:.:.|...|.:|..:
  Fly   467 ADVIDEVARFRNKAGVSRYTSLILESSHFTLLRKIWVVPECPKYYTISYVMPRDSPWEDAVNALL 531

  Fly   538 MWMRSVGLLSVWSRWELS--ESYLRN--------EQSFQVLGTMELYAIFLMVLVGLIVGLLVFI 592
            :...:.||:..|.:.|.|  :..:|:        .:..:||...:|...|.:|:.|.::..|.|:
  Fly   532 LRFLNAGLIVKWIQDEKSWVDIKMRSNILEADAESELVRVLTIGDLQLAFYVVIGGNLLAFLGFL 596

  Fly   593 LE 594
            .|
  Fly   597 AE 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497 19/105 (18%)
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 12/73 (16%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 25/126 (20%)
Lig_chan 319..587 CDD:278489 57/302 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.