DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7e and Gria4

DIOPT Version :9

Sequence 1:NP_001138176.1 Gene:Ir7e / 7354417 FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_001106655.1 Gene:Gria4 / 29629 RGDID:61863 Length:902 Species:Rattus norvegicus


Alignment Length:546 Identity:95/546 - (17%)
Similarity:173/546 - (31%) Gaps:153/546 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 GDILFYSYYPFGEHGCSDMEPQL-------------INRYNGSMLVEPDLF------PRKLRNFF 208
            ||.|.....|:|:.  .|||..|             .:.|...:....|:|      |||:..:.
  Rat   329 GDCLANPAAPWGQG--IDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWN 391

  Fly   209 GCPLRCALWDVPPFLTLDED------------------------QEEVLRVNGGYEGRLLLALAE 249
            .......:.|:|   ||..|                        ..|:...|..|||..:...:|
  Rat   392 DMDKLVLIQDMP---TLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASE 453

  Fly   250 -----KMNFTIAV--------RKVHVNMRDEALEMLRRDEVDLTLGGIRQTVARGMVATSSHNYH 301
                 .:.:.||:        |.....:.:..:..|...:.::.:..:..|:.|..|...|..:.
  Rat   454 IAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFM 518

  Fly   302 QTREVFGVLASSYELSSFDILFY--PYRLQIWMGIL-GVVALSALIQLIVGRMLRERMGSRF--- 360
            ...  ..::....:.|...:..:  |...:|||.|: ..:.:|.::.|:          |||   
  Rat   519 SLG--ISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLV----------SRFSPY 571

  Fly   361 ----------------------------WLNLELVFVGMPLLECPRSHTARLYCVMLMMYTLIIR 397
                                        |.:|. .|:.......|||.:.|:...:...:||||.
  Rat   572 EWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLG-AFMQQGCDISPRSLSGRIVGGVWWFFTLIII 635

  Fly   398 TIYQGLLYHLIRTHQLNRWPQTIESLVQKNFTVVLTPIVQEVLDEIPSVQHMRFRLLEANSELDP 462
            :.|...|...:...::....::.|.|.::      |.|....||...:.:..| |...|..|...
  Rat   636 SSYTANLAAFLTVERMVSPIESAEDLAKQ------TEIAYGTLDSGSTKEFFR-RSKIAVYEKMW 693

  Fly   463 LYFLEANHQLRQHVTA------------------SALDIFIHFNRLSADKVHQRGEQGSGAHFEI 509
            .|...|...:....||                  |.::.:|. .|...|.:...|...|..:...
  Rat   694 TYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIE-QRKPCDTMKVGGNLDSKGYGVA 757

  Fly   510 VPEDIISMQLTMYLAKHSFLIDQLNEEIMWMRSVGLL-SVWSRW-----ELSESYLRNEQSFQVL 568
            .|             |.|.|.:.:|..::.:...||| .:.::|     |.......::.....|
  Rat   758 TP-------------KGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSAL 809

  Fly   569 GTMELYAIFLMVLVGLIVGLLVFILE 594
            ....:..:|.:::.||.:.:||.::|
  Rat   810 SLSNVAGVFYILVGGLGLAMLVALIE 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497 19/131 (15%)
Gria4NP_001106655.1 PBP1_iGluR_AMPA_GluR4 28..398 CDD:107383 15/70 (21%)
ANF_receptor 39..380 CDD:279440 12/52 (23%)
PBP2_iGluR_AMPA_GluR4 414..795 CDD:270445 67/414 (16%)
Lig_chan 546..825 CDD:278489 54/310 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350117
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.