DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7e and Ir41a

DIOPT Version :9

Sequence 1:NP_001138176.1 Gene:Ir7e / 7354417 FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_995744.4 Gene:Ir41a / 2768714 FlyBaseID:FBgn0040849 Length:648 Species:Drosophila melanogaster


Alignment Length:502 Identity:110/502 - (21%)
Similarity:187/502 - (37%) Gaps:139/502 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 LINRYNGS---MLVEPDLFPRKLRNFFGCPLRCALWDVPPFLTLDEDQE---EVLRVNG------ 237
            |::||..|   ......||..||.|..|..:..|.:|.||:..:..:..   :.:.|:|      
  Fly   183 LVDRYLASEQRFQFGKSLFADKLNNLQGREVIIAGFDYPPYTVIKHNMSTNAQDMGVSGESDFKN 247

  Fly   238 ----GYEGRLLLALAEKMNFTIAV--------RKVHVNMR-DEALEMLRRDEVDLTLGGI----- 284
                |.|.|::|...|:.|.||.:        .||:.||. |.||.||...:.|:.:|.:     
  Fly   248 VYIDGTETRIVLNFCEQFNCTIQIDSSAANDWGKVYPNMSGDGALGMLINRKADICIGAMYSWYE 312

  Fly   285 --------RQTVARGMVATSSHNYHQTREVFGVLASSYELSSFDILFYPYRLQIWMGILGVVALS 341
                    ...|..|:..              ::.:...|:|:.:...|::..:|..||..:...
  Fly   313 DYTYLDLSMYLVRSGITC--------------LVPAPLRLTSWYLPLEPFKETLWAAILLCLCAE 363

  Fly   342 ALIQLIVGRMLRERM----GSR--FWLNLEL-------VFVGMPLLECPRSHTARLYCVMLMMYT 393
            | ..|::.....:.:    |.|  :|.....       :|:.........|.|.|:......:..
  Fly   364 A-TGLVLAYKSEQALYVLPGYREGWWTCTSFGVCTTFKLFISQSGNSKAYSLTVRVLLFACFLND 427

  Fly   394 LIIRTIYQGLLYHLIRTHQLNRWPQTIESLVQKNFTVVLTPIVQEVLDEIPSVQHMRFRLLE--A 456
            |||.:||.|.|                       .:::..|.:.|..|   :|..:||..|:  |
  Fly   428 LIITSIYGGGL-----------------------ASILTIPSMDEAAD---TVTRLRFHRLQWAA 466

  Fly   457 NSELDPLYFLEANHQLRQHVTASALDIFIHFNRLSADKV-------HQR----GEQGSGAHFEI- 509
            |||.    ::.|   :|....|...||..:|:..|.|::       |.|    .|:....||.| 
  Fly   467 NSEA----WVSA---IRASDEALVKDILYNFHIYSDDELLRLAQDQHMRIGFTVERLPFGHFAIG 524

  Fly   510 ------------VPEDIISMQLTMYLAKHSF-LIDQLNEEIMWMRSVGLLSVWSRWELSESY-LR 560
                        :.:|.|..|.|:......: |:|:||..|....|.|....|....::::. |:
  Fly   525 NYLGPQAIDQLVIMKDDIYFQYTVAFVPRLWPLLDKLNTLIYSWHSSGFDKYWEYRVVADNLNLK 589

  Fly   561 NEQSFQ--VLGTMEL---------YAIFLMV-LVGLIVGLLVFILEL 595
            .:|..|  :.||.::         :|.|::| ::|..:..|.|:|||
  Fly   590 IQQQVQETMTGTKDIGPVPLGMSNFAGFIIVWILGSAIATLTFLLEL 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497 26/129 (20%)
Ir41aNP_995744.4 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440223
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.