DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7e and W02A2.5

DIOPT Version :9

Sequence 1:NP_001138176.1 Gene:Ir7e / 7354417 FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_502564.2 Gene:W02A2.5 / 189098 WormBaseID:WBGene00012190 Length:487 Species:Caenorhabditis elegans


Alignment Length:466 Identity:78/466 - (16%)
Similarity:169/466 - (36%) Gaps:136/466 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 FFGCP--------LRCAL----------------WDVPPFLT------LDEDQEEVLRVNGGYEG 241
            |..||        |:|..                |::.|.:|      ||..   .|:.||.:.|
 Worm    19 FANCPLFPTLDVILQCPFPGWTMEVLKMITDSLKWEIIPVVTPTIVGGLDWG---TLQKNGTWSG 80

  Fly   242 RLLLALAEKMNFTIAVRKVHVNMRDEALEMLRRDEVDLTLGGIRQTVARGMVATSSHNYHQTREV 306
                                      .|..|:....|......::|..|......|:.....:.|
 Worm    81 --------------------------VLGYLQNGTADAVALMYQKTDTRNEYFEYSYPVTNVQPV 119

  Fly   307 FGVLASSYELSSFDIL---FYPYRLQIWMGILGVVALSALIQL-IVGRMLRERMGSRF--WLNLE 365
            |.....:..|.|  :|   |.|:.:::|:.:|..:.|:.||.: |.|...:....|||  |   |
 Worm   120 FVARKKTETLGS--VLWNAFKPFSVEVWLCLLASLVLNLLIMIAISGIEFKLLFRSRFRPW---E 179

  Fly   366 LVFVGMPLLECPRSHTARLYC----VMLMMYTL----IIRTIYQG-LLYHLIRTHQLNRW---PQ 418
            :::..:.|....:|.....|.    ::|.::.|    |:..:|:| ||..||.::..|.:   .:
 Worm   180 MLWHVVQLQLDEKSDDMLFYTLSGNIVLFVFALLQSGILIEVYKGMLLTALITSNGDNPFANADE 244

  Fly   419 TIESLVQKNFTVVLTPIVQEVLDEIPSVQHMRFRLLEANSELDPLYFLEANHQLRQHVTASALDI 483
            .|:.:.:|.:.:....:.....|::.......|..|.|.:..:|:        :.....::|||:
 Worm   245 MIKLIGEKKYHLTTNYMGNWYFDDLQHSDQQHFVSLRAATASNPV--------IPAASVSAALDL 301

  Fly   484 FIHFNRLSADKVHQRGEQGSGAHFEIVPEDIISMQLTMYLAKHSFLID---QLNEEIMWMRSV-G 544
            .                 .||.:...:.:|.::||::.....:.::.|   |::...::.::. |
 Worm   302 V-----------------DSGKYIYPIQQDSLAMQMSKERCNYVYVSDGMPQVSSFFVFTKNFSG 349

  Fly   545 LLSVWSRWELSESYLRN------EQSFQV-------------------LGTMELYAIFLMVLVGL 584
            :....::..:::::::.      .:.|::                   |....:..:|.:..:|:
 Worm   350 IAEFNTQIIMNQAFIQRTFNKYFNEGFKLGFIPKCEVTEPTASDATKPLDIESVIGVFTIGALGV 414

  Fly   585 IVGLLVFILEL 595
            ...|:||:.|:
 Worm   415 AASLMVFVFEI 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497 16/100 (16%)
W02A2.5NP_502564.2 Lig_chan-Glu_bd <36..86 CDD:214911 10/78 (13%)
Periplasmic_Binding_Protein_Type_2 <74..>124 CDD:304360 11/75 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.