DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7e and Grin3b

DIOPT Version :9

Sequence 1:NP_001138176.1 Gene:Ir7e / 7354417 FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_579842.2 Gene:Grin3b / 170796 RGDID:621705 Length:1002 Species:Rattus norvegicus


Alignment Length:496 Identity:98/496 - (19%)
Similarity:171/496 - (34%) Gaps:140/496 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LVE-PDLFPRKLRNFFGCPLRCALWDVPPFLTLDEDQEEVLR--------VNG-----------G 238
            ||| |.:|.|:......||        ...|.||....:..|        |||           |
  Rat   422 LVEHPFVFTRESDEDGQCP--------AGQLCLDPGTNDSARLDALFAALVNGSVPRTLRRCCYG 478

  Fly   239 YEGRLLLALAEKMNFTIAVRKV----HVNMRDEALEMLRRDEVDLTLGGIRQTV-------ARGM 292
            |...||..|||.:.|...:..|    :..:||.....|   ..||..|.....|       ||..
  Rat   479 YCIDLLERLAEDLAFDFELYIVGDGKYGALRDGRWTGL---VGDLLAGRAHMAVTSFSINSARSQ 540

  Fly   293 VATSSHNYHQTREVFGVLASSYELSS-FDILFYPYRLQIWMGILGVVALSALI------------ 344
            |...:..:..|.  .|::..:.:.:| .....:|....:|:|:...:.|:||.            
  Rat   541 VVDFTSPFFSTS--LGIMVRTRDTASPIGAFMWPLHWSMWVGVFAALHLTALFLTLYEWRSPYGL 603

  Fly   345 ---------------------QLIVGRMLRERM----GSRFWLNLELVFVGMPLLECPRSHTARL 384
                                 .::.||.:..:.    ..||.:||..:|..:.|    .|:||.|
  Rat   604 TPRGRNRGTVFSYSSALNLCYAILFGRTVSSKTPKCPTGRFLMNLWAIFCLLVL----SSYTANL 664

  Fly   385 YCVMLMMYTL-IIRTIYQGLLYHLIRTHQLNR-WPQTIESLVQKNFTVVLTPIVQEVLDEIPSVQ 447
            ..||:...|. .:..|:...|:|..:..:... |..:.|:.::.:|..:...:.:.   ..|:..
  Rat   665 AAVMVGDKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYIKASFPEMHAHMRRH---SAPTTP 726

  Fly   448 HMRFRLLEANSELDPLYFLEANHQLRQHVTASALDIFIHFNRLSAD-KVHQRGE----QGSGAHF 507
            |....|.....:|:...           :..|.||..:   .:.|| |:...|:    :|.|   
  Rat   727 HGVAMLTSDPPKLNAFI-----------MDKSLLDYEV---SIDADCKLLTVGKPFAIEGYG--- 774

  Fly   508 EIVPEDIISMQLTMYLAKHSFLIDQLNEEIMWMRSVGLLSVWSRWELSESYLR----NEQSFQVL 568
                         :.|.::|.|...|:|.|...:|.|.:.:     |.:.:.:    .::.|.|.
  Rat   775 -------------IGLPQNSPLTSNLSEFISRYKSSGFIDL-----LHDKWYKMVPCGKRVFAVT 821

  Fly   569 GTMEL-----YAIFLMVLVGLIVGLLVFILELVSMRSIYLR 604
            .|:::     ..:|:::.:||...||..:.|.|..|.:..|
  Rat   822 ETLQMGVYHFSGLFVLLCLGLGSALLTSLGEHVFYRLVLPR 862

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497 28/124 (23%)
Grin3bNP_579842.2 PBP1_iGluR_NMDA_NR3 21..405 CDD:107372
PBP2_iGluR_NMDA_Nr3 414..808 CDD:270438 86/440 (20%)
Lig_chan 576..842 CDD:278489 52/307 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 882..910
Involved in the trafficking and surface expression of NMDARs. /evidence=ECO:0000250 951..984
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350131
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.