DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7e and gria3a

DIOPT Version :9

Sequence 1:NP_001138176.1 Gene:Ir7e / 7354417 FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster
Sequence 2:XP_005165152.1 Gene:gria3a / 170452 ZFINID:ZDB-GENE-020125-5 Length:903 Species:Danio rerio


Alignment Length:153 Identity:32/153 - (20%)
Similarity:63/153 - (41%) Gaps:40/153 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 MMYTLIIRTIYQGLLYHLIRTHQLNRWPQTI----------------ESLVQKNFTV-------V 431
            :.:.|.:|...:|.|..|:..:   :|.:.:                ||.|..|:.|       :
Zfish   128 VQFVLQMRPSLRGALLSLLAHY---KWEKFVYLYDTDRGFSILQAIMESAVMNNWQVTARSVGNI 189

  Fly   432 LTPI-VQEVLDEIPSVQHMRFRLLEA-----NSELDPLYFLEANHQLRQHVTASALDIFIHFNRL 490
            :.|: .:.:::|:...|..|| |::.     ||.|:.:.....|.:...::.|:     :.|..:
Zfish   190 VDPLEYRRIIEEMDRRQEKRF-LIDCEVERINSILEQVVIAGKNSRGYHYILAN-----LGFTNM 248

  Fly   491 SADKVHQRGEQGSGAHFEIVPED 513
            |.|||...|...:|  |:|:..|
Zfish   249 SLDKVFSGGANITG--FQIINPD 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497
gria3aXP_005165152.1 PBP1_iGluR_AMPA_GluR3 28..399 CDD:107382 32/153 (21%)
ANF_receptor 39..382 CDD:279440 32/153 (21%)
PBP2_iGluR_AMPA 415..797 CDD:270433
Lig_chan 547..810 CDD:278489
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591778
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.