DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7e and Grin2b

DIOPT Version :9

Sequence 1:NP_001138176.1 Gene:Ir7e / 7354417 FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_001350679.1 Gene:Grin2b / 14812 MGIID:95821 Length:1482 Species:Mus musculus


Alignment Length:424 Identity:63/424 - (14%)
Similarity:139/424 - (32%) Gaps:136/424 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 RVNGGYEGRLLLALAEKMNFTIAVRKVHVNMRDEALEMLRRDEVDLTLGGIRQTVARGMVATSSH 298
            ::||.:.|         |...:.:::.::.:....:...|.:.||.::..| :|....||:.|: 
Mouse   489 KINGTWNG---------MIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFI-ETGISVMVSRSN- 542

  Fly   299 NYHQTREVFGVLASSYELSSFDILFYPYRLQIWMGILGVVALSALIQLIV---------GRMLRE 354
                     |.::.|..|.       |:...:|:.:..::.:.:.:.:.|         .|.|.:
Mouse   543 ---------GTVSPSAFLE-------PFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLAD 591

  Fly   355 ---------RMGSRFWLNLELVFVGMPLLECPRSHTARLYCVMLMMYTLIIRTIYQGLLYHLIRT 410
                     .:|...||...|||.....::.|:..|:::...:...:.:|....|...|...:  
Mouse   592 GREPGGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFM-- 654

  Fly   411 HQLNRWPQTIESLVQKNFTVVLTPIVQEVLDEIPSVQHMRFRLLEANSELDPLYF-LEANHQLRQ 474
                                    |.:|.:|::..:...:|:  ..|....|..| ...|....:
Mouse   655 ------------------------IQEEYVDQVSGLSDKKFQ--RPNDFSPPFRFGTVPNGSTER 693

  Fly   475 HVTASALDIFIHFNRLSADKVHQRGEQGSGAHFEIVPEDIISMQLTMYLAKHSFLID-------- 531
            ::..:..::..:..     |.:|||          |.:.::|::....   .:|:.|        
Mouse   694 NIRNNYAEMHAYMG-----KFNQRG----------VDDALLSLKTGKL---DAFIYDAAVLNYMA 740

  Fly   532 ------------------------QLNEEIMWMRSVGL--LSVWSRWELSESYL----------R 560
                                    .:.::..|.|.|.|  |.::...|:.|...          :
Mouse   741 GRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAILQLFGDGEMEELEALWLTGICHNEK 805

  Fly   561 NEQSFQVLGTMELYAIFLMVLVGLIVGLLVFILE 594
            ||.....|....:..:|.|:...:.:.|:.||.|
Mouse   806 NEVMSSQLDIDNMAGVFYMLGAAMALSLITFICE 839

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497 13/78 (17%)
Grin2bNP_001350679.1 PBP1_iGluR_NMDA_NR2 33..388 CDD:380601
PBP2_iGluR_NMDA_Nr2 403..803 CDD:270436 54/386 (14%)
NMDAR2_C 840..1482 CDD:402274 63/424 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846452
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.