Sequence 1: | NP_001138176.1 | Gene: | Ir7e / 7354417 | FlyBaseID: | FBgn0259189 | Length: | 608 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_619635.1 | Gene: | GRIN3B / 116444 | HGNCID: | 16768 | Length: | 1043 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 38/198 - (19%) |
---|---|---|---|
Similarity: | 68/198 - (34%) | Gaps: | 53/198 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 278 DLTLGGIRQTV-------ARGMVATSSHNYHQTREVFGVLASSYELSS-FDILFYPYRLQIWMGI 334
Fly 335 LGVVALSAL-----------------------------IQLIVGRMLRERMGS--------RFWL 362
Fly 363 NLELVFVGMPLLECPRSHTARLYCVMLMMYTL-IIRTIYQGLLYHLIRTHQLNR-WPQTIESLVQ 425
Fly 426 KNF 428 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ir7e | NP_001138176.1 | PBPb | 218..>313 | CDD:214497 | 9/41 (22%) |
GRIN3B | NP_619635.1 | PBP1_iGluR_NMDA_NR3 | 19..405 | CDD:107372 | |
PBP2_iGluR_NMDA_Nr3 | 415..808 | CDD:270438 | 38/198 (19%) | ||
Lig_chan | 576..842 | CDD:278489 | 27/139 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165156193 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1052 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |