DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7e and GRIN3B

DIOPT Version :9

Sequence 1:NP_001138176.1 Gene:Ir7e / 7354417 FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster
Sequence 2:NP_619635.1 Gene:GRIN3B / 116444 HGNCID:16768 Length:1043 Species:Homo sapiens


Alignment Length:198 Identity:38/198 - (19%)
Similarity:68/198 - (34%) Gaps:53/198 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 DLTLGGIRQTV-------ARGMVATSSHNYHQTREVFGVLASSYELSS-FDILFYPYRLQIWMGI 334
            ||..|.....|       ||..|...:..:..|.  .|::..:.:.:| .....:|.....|:|:
Human   519 DLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTS--LGIMVRARDTASPIGAFMWPLHWSTWLGV 581

  Fly   335 LGVVALSAL-----------------------------IQLIVGRMLRERMGS--------RFWL 362
            ...:.|:||                             :.|....:.|..:.|        |..:
Human   582 FAALHLTALFLTVYEWRSPYGLTPRGRNRSTVFSYSSALNLCYAILFRRTVSSKTPKCPTGRLLM 646

  Fly   363 NLELVFVGMPLLECPRSHTARLYCVMLMMYTL-IIRTIYQGLLYHLIRTHQLNR-WPQTIESLVQ 425
            ||..:|..:.|    .|:||.|..||:...|. .:..|:...|:|..:..:... |..:.|:.::
Human   647 NLWAIFCLLVL----SSYTANLAAVMVGDKTFEELSGIHDPKLHHPAQGFRFGTVWESSAEAYIK 707

  Fly   426 KNF 428
            |:|
Human   708 KSF 710

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497 9/41 (22%)
GRIN3BNP_619635.1 PBP1_iGluR_NMDA_NR3 19..405 CDD:107372
PBP2_iGluR_NMDA_Nr3 415..808 CDD:270438 38/198 (19%)
Lig_chan 576..842 CDD:278489 27/139 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156193
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.