DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7e and grin3bb

DIOPT Version :9

Sequence 1:NP_001138176.1 Gene:Ir7e / 7354417 FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster
Sequence 2:XP_017213803.2 Gene:grin3bb / 100333101 ZFINID:ZDB-GENE-131122-77 Length:1114 Species:Danio rerio


Alignment Length:279 Identity:60/279 - (21%)
Similarity:96/279 - (34%) Gaps:76/279 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LVE-PDLFPRKLRNFFGCPL--RCALWDVPPFLTLDEDQEEVLRVNG--------------GYEG 241
            ||| |.:|.|::.....||.  .|.........|||....|  |..|              ||..
Zfish   463 LVEHPFVFTREVDEDGNCPAGQYCLDAGTNSSETLDHLYAE--RAQGNKSFLPPDYSKCCYGYCI 525

  Fly   242 RLLLALAEKMNFTIAVRKVHVNMRDEALEMLRRDEVDLTLGGIRQTVARGMVATSSHNYHQTREV 306
            .||..|:|.|||...:..|    .|.....::..:....:|.:...||...|.:.|.|..:::.:
Zfish   526 DLLEKLSEDMNFEFDLYIV----GDGKYGAVKGGQWTGLVGDLLSGVADMAVTSFSINSARSKVI 586

  Fly   307 ----------FGVLASSYELSS-FDILFYPYRLQIWMGILGVVALSALI---------------- 344
                      .|:|..|.:.:: .....:|....:||||...:.::||.                
Zfish   587 DFTSPFFSTSLGILVRSKDTAAPIGAFMWPLHWSMWMGIFVALHITALFLTLYEWKSPFGMTPHG 651

  Fly   345 -----------------QLIVGRMLRER----MGSRFWLNLELVFVGMPLLECPRSHTARLYCVM 388
                             .::.||.:..:    ...||.:||..:|..:.|    .|:||.|..||
Zfish   652 RNRVKVFSYSSALNLCYAILFGRTVSSKTPKCWTGRFLMNLWAIFCLLVL----SSYTANLAAVM 712

  Fly   389 LMMYTL-IIRTIYQGLLYH 406
            :...|. .:..|:...|:|
Zfish   713 VGEKTFEEVSGIHDAKLHH 731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497 25/118 (21%)
grin3bbXP_017213803.2 PBP1_iGluR_NMDA_NR3 29..428 CDD:107372
PBP2_iGluR_NMDA_Nr3 457..852 CDD:270438 60/279 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591708
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.